KEGG   Bacteroides fragilis NCTC9343: BF9343_2962Help
Entry
BF9343_2962       CDS       T00239                                 

Definition
(GenBank) putative alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00500  Starch and sucrose metabolism
bfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF9343_2962
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BF9343_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CAH08743
GeneDB: BF3048
UniProt: Q5LAX9
LinkDB All DBs
Position
3544364..3545809
Genome map
AA seq 481 aa AA seqDB search
MENGVMMQYFEWNLPNDGNLWKQLKEDASHLHEIGVTAVWIPPAYKADEQQDEGYATYDL
YDLGEFDQKETVRTKYGTKEELKEMIDELHKNHISVYLDVVLNHKAGGDFTEKFIVVEVD
PNDRTQALGKPFEIQGWTGYSFHGRKDKYSDFKWHWYHFSGTGFDDAKKRSGIFQIQGEG
KAWSEGVDNENGNYDFLLCNDIDLDHPEVVTELNRWGKWVSKELNLDGMRLDAIKHMKDK
FIAQFLDAVRSERGDKFYAVGEYWNGDLNTLDAYIKSVGHKVNLFDVPLHYNLFQASQEG
KNYDLQNILKNTLVGHHCDLAVTFVDNHDSQSGSSLESQIEDWFKPLAYGLILLIKDGYP
CLFYGDYYGVKGENSPHTQIINILLDARRKYAYGDQIEYFDHPSAIGFIRTGDEEHVGSG
LVFLMSNDEAGSKKMDLGEEHKGEIWHEITGNIQQEITLDEKGSGEFSVNTRNIAVWIKK
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtgtaatgatgcagtattttgaatggaatctgccaaatgacggaaattta
tggaaacaattaaaagaagatgcgtcacatttacatgagattggtgtgacagcagtatgg
attccccccgcttacaaagccgacgaacaacaagacgaaggttatgcaacctacgatttg
tatgatctcggcgagttcgatcaaaaagaaaccgtaagaacgaaatatggtacgaaagaa
gaactgaaagaaatgatcgatgaattacataaaaatcatatttccgtttatctggatgta
gtactgaatcataaggcaggaggtgatttcactgaaaagttcatagttgtagaagtcgat
cccaatgatagaacccaagcattaggaaaaccgttcgaaatacagggctggaccggatac
agcttccatggacgtaaggataaatattcagacttcaaatggcattggtatcatttttca
ggaaccggttttgacgatgccaaaaagcggagtggcatcttccagatacagggtgaaggc
aaagcgtggagcgaaggggttgacaatgaaaatggcaactacgatttcttattatgcaat
gatatagacctggatcatcctgaagtagtcaccgaattgaatcgttggggaaaatgggtt
tccaaagagctgaacctcgacggaatgcgtctggatgccatcaaacacatgaaagacaag
ttcattgcacaattcctggatgcggtaagaagcgaaagaggagacaaattctacgctgtt
ggcgaatattggaatggtgatttgaacacactcgatgcatacataaaatccgtgggtcac
aaagtcaacctatttgatgttccattacattataatttattccaagcatcacaagaaggc
aagaattatgatctgcagaatatcctaaaaaacacattagtcgggcaccactgtgatctg
gcagtcacttttgtcgacaatcacgattcgcaatcgggcagttccttggaatcacaaata
gaagactggttcaaaccattggcctatggtctgatattattaataaaagacggttatcct
tgtttgttctacggagattattatggtgtcaaaggagaaaactcacctcatacccaaatc
attaatattcttctggatgccagaagaaaatatgcttatggcgatcagattgagtatttc
gatcatccttccgccattggctttattcgtacgggagatgaagaacatgtcggttccggt
ttagtctttttaatgtctaatgatgaagccggcagtaaaaagatggatttgggcgaagaa
cataaaggtgaaatatggcatgaaataaccggaaatattcagcaagaaatcacattagac
gaaaaaggaagtggagaattttctgttaatacccgtaatattgctgtttggataaaaaag
aattaa

DBGET integrated database retrieval system