Blastomonas fulva: B5J99_12340 Help Entry B5J99_12340       CDS       T05612                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bfw  Blastomonas fulva Brite KEGG Orthology (KO) [BR:bfw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bfw03110]     B5J99_12340 Chaperones and folding catalysts [BR:bfw03110]  Protein folding catalysts   Protein disulfide isomerase    B5J99_12340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 DSBA GST_N SH3BGR Thioredoxin_4 Glrx-like Thioredoxin_3 zf-Di19 Motif Other DBs NCBI-ProteinID:  ASR52150 UniProt:  A0A222WZZ0 LinkDB All DBs Position 2584953..2585210 Genome browser AA seq 85 aa AA seqDB search MAKIEIYTKFTCPYCYRAKSLLGAKGVEFEEVEISMGGEPRAEMIRRAGGRMTVPQIFID GNHIGGSDDLAALDRAGKLDPLLGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccaagatcgaaatctacaccaagttcacctgcccctattgctaccgggccaaatcg ctgctgggcgccaagggcgtcgagttcgaggaagtcgagatctcgatgggcggcgaaccg cgggcggaaatgatccgccgggcaggcggccggatgaccgtcccgcagatcttcattgat ggcaaccatatcggcgggtccgacgatcttgccgcgctcgaccgtgccggaaagctcgat ccgctgctgggcctttga

DBGET integrated database retrieval system