KEGG   Bordetella flabilis: BAU07_15895Help
Entry
BAU07_15895       CDS       T04592                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bfz  Bordetella flabilis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAU07_15895
Enzymes [BR:bfz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAU07_15895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3628188..3629783
Genome map
AA seq 531 aa AA seqDB search
MTLPSRTPPSRDRLLAQLDSAQPWDVIVIGGGATGLGTAVDAAARGYRTLLIEAADFAKG
TSSKATKLVHGGVRYLAQGNISLVREALHERGLLGRNAPHVVWPLGFVVPAYNLLERPFY
GTGMKMYDLLAGRLNLAPSRMLSRAETLADAPTLAPEVNGRRLRGGVRYYDGQFDDARLA
VSLMRTLFDLGGIAINYMPATGLNQSKGRIDGVTARDALTGTSFVLHAKCVVNAAGVWVD
EIRHMESRAATGIVAPSQGVHLTLPHDFLPGKNAILIPKTDDGRVLFVVPWNGHTIVGTT
DVPRADLPLEPEASSQDIDFILRTAGRYLSRKPTRSDVTSVWAGLRPLVKAGGEGATKTL
SREHTILVSPGGLITVTGGKWTTYRRMAQDVMDTAAREHMLPHAPCRTEQLALHGAPGAP
AGMTSPGTPDAYYGSDLPALRALAGADRMLIAASALTEAHVRYAARFELARSAEDVLARR
NRALFLDSGAALRAAPEVARILAEELGHDAAWQRRTVADFEQTAQRYRLAS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccttcccgcacgcccccctcccgcgaccgcctgctggcgcagttggattcc
gcccaaccctgggacgtcatcgtcatcggcggcggcgccaccggcctgggcacggcggtg
gacgccgccgcgcgcggctatcgcaccctgctgatcgaggcggcggatttcgccaagggc
acctccagcaaggccaccaagctggtgcatggcggcgtgcgctacctggcgcagggcaac
atcagcctggttcgcgaagcactgcacgaacgcgggttgctgggccgcaacgcgccgcat
gtggtctggcccctgggtttcgtggtacccgcctacaacctgctggagcggcccttctac
ggcaccggcatgaagatgtacgacctgctggcggggaggctgaacctggcgccgagccgc
atgctgtcccgtgccgaaaccctggccgatgcccccacgctggcgccggaggtgaacggg
cggcggctgcggggcggagtgcgctactacgacggccagttcgacgacgcccggctggcg
gtctcgctgatgcgtaccctgttcgatctcgggggcatcgccatcaactacatgcccgcc
accggcttgaaccagagcaagggccgcatcgacggcgtgacggcgcgcgatgcattgacc
gggaccagcttcgtgctgcacgcgaagtgcgtggtcaatgccgccggggtatgggtcgac
gagatccggcacatggaaagccgtgccgccacgggcatcgtcgcaccgagccagggcgtg
cacctgacgctgccgcacgatttcctgcccggcaagaacgccatcctgatccccaagacc
gatgacggccgcgtgctgttcgttgtgccgtggaatggccataccatcgtcggcaccacc
gatgtgccgcgggccgacctaccgctcgagccggaggccagttcacaggacatcgacttc
atcctgcgcacggccggacgctacctcagccgcaagccgacgcgttccgatgtgaccagc
gtatgggcaggcctgcggccgctcgtgaaggcgggtggcgaaggtgcgaccaagacactg
tcgcgcgagcacaccattttggtgtcgccggggggactgatcacggtaacgggcggcaaa
tggaccacctaccggcgcatggcgcaggacgtcatggataccgctgcgcgggaacacatg
ctgccccacgccccgtgccggaccgagcaattggcgctgcacggcgcgcccggcgcaccg
gccggcatgacctcccccggcacgccggacgcgtactatggcagcgacctgcctgcgctg
cgcgcgctggcgggtgccgaccgcatgctgatcgcggccagcgccctgaccgaagcccac
gtccgctacgccgctcgtttcgagctggcgcgcagcgccgaagacgtgctggcccgtcgc
aaccgggcgctgttcctggatagcggcgcggcgctgcgggccgctcccgaggtcgcgcgc
atcctcgccgaggaactggggcacgatgccgcctggcagcggcgcacggtggcggatttc
gagcagaccgcgcaacggtaccgactggcgtcctga

DBGET integrated database retrieval system