Bufo gargarizans (Asiatic toad): 122928462 Help Entry 122928462         CDS       T07965                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04010   MAPK signaling pathway bgar04012   ErbB signaling pathway bgar04068   FoxO signaling pathway bgar04137   Mitophagy - animal bgar04140   Autophagy - animal bgar04150   mTOR signaling pathway bgar04210   Apoptosis bgar04218   Cellular senescence bgar04370   VEGF signaling pathway bgar04371   Apelin signaling pathway bgar04540   Gap junction bgar04625   C-type lectin receptor signaling pathway bgar04810   Regulation of actin cytoskeleton bgar04910   Insulin signaling pathway bgar04912   GnRH signaling pathway bgar04914   Progesterone-mediated oocyte maturation bgar04916   Melanogenesis Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122928462 (KRAS)    04012 ErbB signaling pathway     122928462 (KRAS)    04370 VEGF signaling pathway     122928462 (KRAS)    04371 Apelin signaling pathway     122928462 (KRAS)    04068 FoxO signaling pathway     122928462 (KRAS)    04150 mTOR signaling pathway     122928462 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122928462 (KRAS)    04137 Mitophagy - animal     122928462 (KRAS)   09143 Cell growth and death    04210 Apoptosis     122928462 (KRAS)    04218 Cellular senescence     122928462 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     122928462 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122928462 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122928462 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     122928462 (KRAS)    04912 GnRH signaling pathway     122928462 (KRAS)    04914 Progesterone-mediated oocyte maturation     122928462 (KRAS)    04916 Melanogenesis     122928462 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bgar04131]     122928462 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bgar04031]     122928462 (KRAS) Membrane trafficking [BR:bgar04131]  Endocytosis   Macropinocytosis    Ras GTPases     122928462 (KRAS) GTP-binding proteins [BR:bgar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122928462 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  122928462 NCBI-ProteinID:  XP_044137249 EnsemblRapid:  ENSBGGG00000010791 LinkDB All DBs Position 2:complement(515675891..515695579) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKMSKEEKTPGC VKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaactggtagtggtcggcgctggaggtgtagggaagagcgccctgacg atacaactcatacagaaccattttgttgatgagtatgatcccactatagaggactcctac aggaagcaagtagtaatcgatggagagacgtgcctcttggatattctggacactgcaggt caagaggagtatagtgccatgagagaccagtacatgaggacgggggagggctttctgtgc gtgtttgccattaataatactaaatcgtttgaggacattcatcattatagagagcagata aagagagtgaaggactctgaggatgtaccgatggtcctagtcggcaataaatgtgactta ccttctagaacagtagacaccaaacaagctcaggacctagcgagaagttacggcatacct tttattgagacctccgcaaaaaccagacagagagtggaggatgctttttatacattggtg cgagaaatccgacaatacagattgaaaaagatgagcaaagaagaaaagacgcctggctgt gtgaaaataaaaaaatgccttgtaatgtga

DBGET integrated database retrieval system