KEGG   Burkholderia gladioli BSR3: bgla_1g31180Help
Entry
bgla_1g31180      CDS       T01464                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bgla_1g31180
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bgla_1g31180
   00680 Methane metabolism
    bgla_1g31180
Enzymes [BR:bgd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     bgla_1g31180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3539979..3543062
Genome map
AA seq 1027 aa AA seqDB search
MKSSGSARAARRNTASSNVTAPASAEAPARARGRQAASPAGPVTTKPARKTASKAAARPE
TKQASAATTKPAAPATSTKRTAAPKTNGRTREDKDQPLFEDIRYLGRLLGDVVREQEGDA
VFQVVETIRQHAVKFRREDDREAAQTLDRMLRKLTPEQTVSVVRAFSYFSHLANIAEDRH
HNRRRRIHALAGSTPQAGTVGFALQTLKDAGDASAEVIRRFFDEALIVPVLTAHPTEVQR
KSILDAQHDIARLLAERDQQLTTRERSHNESLLRARVTSLWQTRMLRDARLTVGDEIDNA
LSYYRATFLDELPALYADIEEALAEHGLEARVPAFFQMGSWIGGDRDGNPNVTAATLEEA
IHRQGTVILEHYLEQVHKLGAELSVSHLLVGASDEVKALAAASPDQSPHRVDEPYRRALI
GIYTRIAASARVRLGEGVVAVRSAGRGAPPVRATPYADSEAFARDLRVLQESLVAHHGAS
LTTPRLAPLVRAAEVFGFHLASIDLRQSSDIHEAVIAELFARAGVEADYAALAEADKLRV
LLAALADPRPLRIPYLDYSDLAKSELGVLEKAREVRAKFGPRAVRNYIISHTETVSDLVE
VLLLQKETGLLEGSFGAHGHARHGLMVIPLFETIADLQNAPEIMRDYFALPGMQALVAHQ
GGEQEVMLGYSDSNKDGGFLTSNWELYRAELSLVELFSAHGIKLRLFHGRGGTVGRGGGP
TYQAILSQPPGTVNGQIRLTEQGEVIASKFSNPEIGRRNLETVVAATLEASLLPRNNAPA
QLPAFEATMQTLSDAAMGAYRALVYETPGFKDYFFASTPISEIAELNIGSRPASRKLQDP
KNRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAFAAYLDGAANSANPAAERAKRLALLQK
MNRNWPFFSHLLSNMDMVLAKTDLAVASRYAELVADKKLRKHVFARIVAEWERTAAALAE
ITGHEARLAANPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARVRRGIHLTINGIA
AGLRNTG
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctccggatcggcgcgcgccgcgcgccgcaatactgcctcgtccaacgtcacc
gcgccggcgagcgccgaagcgcccgcgcgagcgcgcggcaggcaggccgccagcccggcc
ggcccagttacgacgaaaccggcccgcaagaccgccagcaaggcggccgccaggccggaa
accaagcaggcaagcgccgcgaccacgaaacccgccgccccggccacctcgaccaagcgc
accgccgcgccgaaaacgaacggccgtacgcgcgaggacaaggaccagccgctgttcgag
gacatccgctacctgggacgcctgctcggcgacgtggtgcgcgagcaggaaggcgacgcg
gtgttccaggtggtcgagacgatccgccagcacgccgtgaaattccgccgcgaggacgac
cgcgaggccgcgcagacgctcgaccgcatgctgcgcaagctcacgcccgagcagaccgtc
agcgtggtgcgcgccttcagctacttctcgcacctggccaatatcgccgaggaccgccat
cacaaccgccgccgccgcatccacgcgctggccggctcgacgccgcaggccggcacggtc
ggcttcgcgctgcagacgctgaaggacgctggcgacgcctcggccgaggtgatccgccgc
ttcttcgacgaggccctgatcgtgccggtgctgaccgcccacccgaccgaggtgcagcgc
aagagcatcctcgacgcccagcacgacatcgcccgcctgctcgccgagcgcgaccagcaa
ctgaccacgcgcgagcgctcgcacaacgaatcgctgctgcgcgcgcgcgtgacctcgctg
tggcagacccgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgacaacgcg
ctgtcctattaccgcgccaccttcctcgacgagctgccggcgctctacgccgacatcgag
gaggcgctggccgagcacggcctggaagcgcgcgtgccggccttcttccagatgggcagc
tggatcggcggcgaccgcgacggcaacccgaacgtgaccgccgccaccctggaggaggcg
atccatcggcaaggcacggtgatcctcgagcactacctggagcaggtccacaagctcggc
gccgagctgtcggtctcgcacctgctggtgggcgccagcgacgaagtgaaggcgctggcc
gcggcctcgcccgaccagtcaccgcatcgcgtcgacgagccctaccggcgcgcgctgatc
ggcatctacacgcgcatcgccgccagcgcccgggtgcgcctgggcgagggcgtggtggcg
gtgcgcagcgccggccgcggcgcgccgccggtgcgcgccacgccctatgccgactccgag
gccttcgcgcgcgatttgcgcgtgctgcaggaatcgctggtcgcgcatcacggcgcctcg
ctgaccacgccgcgcctggcgccgctggtgcgcgccgccgaggtgttcggcttccacctg
gccagcatcgacctgcgccagagctcggacatccacgaggcggtgatcgccgagctgttc
gcgcgcgccggcgtcgaggccgactacgcggcgctcgccgaagccgacaagctgcgcgtg
ctgctggccgcgctggccgacccgcgcccgctgcgcatcccctatctcgactattccgat
ctcgcgaagagcgaactcggcgtgctcgagaaggcccgcgaggtgcgtgccaagttcggc
ccgcgcgcggtgcgcaactacatcatctcgcacaccgaaacggtatcggacctggtcgag
gtgctgctgctgcagaaggaaaccggcctgctcgaaggcagcttcggcgcgcacggccat
gcccggcacggcctgatggtgatcccgctgttcgagaccatcgccgacctgcagaacgcg
cccgagatcatgcgcgactacttcgcgctgcccggcatgcaggcgctggtcgcccaccag
ggcggcgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttcctg
acctcgaactgggagctgtatcgcgccgagctgtccctggtcgagctgttcagcgcccac
ggcatcaagctgcgcctgttccacggccgcggcggcacggtcggccgcggcggcggcccg
acctaccaggcgatcctctcgcagccgccgggcaccgtgaacggccagatccgcctgacc
gagcagggcgaggtgatcgccagcaagttctcgaaccccgagatcggccggcgcaacctg
gagacggtggtggccgccacgctggaggcctcgctgctgccgcgcaacaacgcgcccgcg
caactgcccgccttcgaggcgaccatgcagacgctgtcggacgcggcgatgggtgcctat
cgcgcgctggtctatgaaacgcccggcttcaaggactacttcttcgcctcgacgccgatc
agcgagatcgccgagctcaacatcggcagccgcccggcctcgcgcaagctgcaggacccg
aagaaccgcaagatcgaggacctgcgcgcgattccctggggcttctcgtggggccagtgc
cggctgctgctgaccggctggtacggcttcggcagcgccttcgcggcctacctcgacggc
gcggccaactcggccaaccccgcagccgagcgcgccaagcgcctggctttgctgcagaag
atgaaccgcaactggccgttcttctcgcacctgctgtcgaacatggacatggtgctggcc
aagaccgacctggccgtggcctcgcgctacgccgagctggtggccgacaagaagctgcgc
aagcacgtgttcgcgcgcatcgtcgccgaatgggagcgcaccgccgccgcgctggccgag
atcaccggccacgaggcgcggctggcggccaacccgctgctggcgcgttcgatcaagaac
cgcttcccctacctcgatccgctcaaccacctgcaggtcgagctgatcaagcggcaccgc
gcgggcgacaccaatgcgcgcgtgcggcgcgggatccatctgaccatcaacggcatcgcg
gcgggcctgcgcaataccggctga

DBGET integrated database retrieval system