KEGG   Burkholderia gladioli BSR3: bgla_2g13360Help
Entry
bgla_2g13360      CDS       T01464                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00440  Phosphonate and phosphinate metabolism
bgd01100  Metabolic pathways
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    bgla_2g13360
Enzymes [BR:bgd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     bgla_2g13360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL PEP_hydrolase IspD PucR NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AEA63782
UniProt: F2LJ92
LinkDB All DBs
Position
2:complement(1659814..1661499)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRAARLRRMLTSSNLEFLMEAHNGLSARIVREAGFKGIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILMHSKLSRPDEILEFARQWNNRAPIVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSAAASMQATARDIFENQTLVNVEDRVATVNEIFRLQDADEYSAAERIYLSSS
SRSSNSAIVLAASRGKGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDTAGIKLVVNERHAETGELSSLACALERIKGDTIVSYGDLLFRSYIVRDLAESDAE
FTVVVDSSLTDSPNQSVRDFALCSAPDDRGLFGQKITLQRVAGDAGNGAPHGRWVGLLNV
RGAGVERLKATIAKLQARPDFDQLDIPALLNALVDAGEQISVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLANGAAAGDAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaatttcaccgaatcccgcgcggcgcggctgcgccgcatgctg
accagcagcaacctcgaattcctgatggaagcgcacaacggcctgtcggcgcgcatcgtg
cgcgaggccggcttcaagggcatctggggctcgggcctgtcgatctcggccgcgctcggc
gtgcgcgacaacaacgaggcgagctggacccaggtggtcgacgtgctcgagttcatggcc
gatgccagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtacgcaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcaattccccaagaccaacagcttcatcgacggcgagcgccagccgctggccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattcgcagaccgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgatgccggcgccgacgcgatcctgatgcacagcaagctgtcgcgt
ccggacgagatcctcgaattcgcgcggcagtggaacaaccgcgcgccgatcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctggtccgctcggcggcggcctcgatgcaggccaccgcgcgcgac
atcttcgagaaccagaccctggtcaacgtcgaggaccgcgtcgccaccgtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgcatctacctgtcctcctcc
tcgcgttcgtcgaactcggcgatcgtgctggccgccagccgcggcaagggcctggaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgctgcgctgg
ctggtggacggcttcaagaaggaaggcgtcaacgacatcacggtggtgggcggctatcgc
gccgacgcgatcgacaccgccggcatcaagctggtggtcaacgagcgccacgccgaaacc
ggcgaactgagctcgctggcctgcgcgctcgagcgcatcaagggcgacaccatcgtctcc
tacggcgacctgctgttccgcagctacatcgtgcgcgacctggccgagagcgatgccgaa
ttcacggtggtggtcgattcctcgctgaccgattcgccgaaccagagcgtgcgcgacttc
gccctgtgctcggcgcccgacgaccgcggcctgttcggccagaagatcacgctgcagcgc
gtggcgggcgacgccggcaacggcgcgccgcacggccgctgggtcggcctgctgaacgta
cgcggcgccggcgtggagcgcctcaaggcgaccatcgcgaagctgcaggcacgcccggac
ttcgaccagctcgacatcccggccctgctcaatgcgctggtggacgccggcgagcagatc
tccgtgcaatacgtgcacggccactggcgcggcgtgaacgacctcgacgaattccgtcgc
gccggcgacttcgcccacggccagacgccgctggccaacggcgccgccgccggggacgcg
caatga

DBGET integrated database retrieval system