KEGG   Burkholderia sp. CCGE1002: BC1002_0773Help
Entry
BC1002_0773       CDS       T01217                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_0773
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_0773
   00680 Methane metabolism
    BC1002_0773
Enzymes [BR:bge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BC1002_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(852275..855493)
Genome map
AA seq 1072 aa AA seqDB search
MTSSGSARPARRNTASPTARPADAAAPDVLSDAAAHGRSSSVADQRAKRRAIAAQAAKAS
KASQTTVPVKQDKAQKAPKAGKAEKAATSATASKPAKVKIKVDGDATPPRAAKAERLEAM
PQAESAAAPTVKNGGGRTREDKDHPLFQDIRYLGRLLGDVLREQEGDAVFDVVETIRQNA
VRFRREDDSAAAQTLDKKLRSLTPEQTVSVVRAFSYFSHLANIAEDRHRNRRHRIHALAG
SASQPGTIAHALERLVAAGAAATPVLQRFFDDALIMPVLTAHPTEVQRKSILDAQHDIAR
LLAERDQPLTNRERAHNEAMLRARVTSLWQTRMLRDARLTVADEIENALSYYRSTFLEEL
PALYADIEEALKEHGLEARLPPFFQMGSWIGGDRDGNPNVTAETLENAITRQAAVIFEHY
LVQVHKLGEELSMSNVLVGVSDALNELADISPDHSPHRTDEPYRRALIGIYTRLAASARV
RLGEGSVPLRSAGRGVAPIRATPYDDAADFVRDLHVLIDSLAEHHGAPLAAPRLAPLARA
AEVFGFHLASIDLRQSSDIHEAVIAELLKRAGVEDDYAGLSEANKLKVLLAELAQPRALR
VPYAEYSDLVKSELAVLEEARITREKFGARAVRNYIISHTETVSDLVEVMLLQKETGLLL
GHLGDEHDPARASLMVIPLFETIPDLRNAPHIMRDLIALPGIGALIEHQGNEQEVMLGYS
DSNKDGGFLTSNWELYRAELALVSLFNERGVTLRLFHGRGGTVGRGGGPTYQAILSQPPG
TVAGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEASLLPHDHTLAELPVYEETMQQ
LSDTAMAAYRALVYETPGFKEYFFESTPIAEIAELNIGSRPASRKLQDPKQRKIEDLRAI
PWGFSWGQCRLLLTGWYGFGSAVTEHLDSAPSDAERARRLALLKKMHKSWPFFANLMSNM
DMVIAKTDLAVASRYAALVTDKKLRKHVFERIVAEWERTSKVLSEITGKSERLAENPLLA
RSIKNRFPYLDPLNHLQVELLKRYRAGDTNARVRRGIHLCINGIAAGLRNTG
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccccgcccgccgcaacactgcctcgcccaccgctcgc
ccggccgacgccgcggcgcccgacgtcctgtccgacgctgccgcgcacggcagatcgtcg
agcgtcgccgaccagcgcgcgaagcgccgcgccatcgccgcgcaagccgccaaggcctcg
aaggcctcgcaaaccacagtgcccgtcaagcaggacaaggcgcaaaaggcaccgaaagcc
ggcaaggccgaaaaagccgcgacttcggctaccgccagcaaaccggccaaggtcaagatc
aaggtcgatggcgacgcaacgcctccccgcgccgcgaaagcggaaaggctcgaagccatg
ccgcaggctgagtccgccgccgcgcccaccgtcaagaacggcggcggccgcacgcgcgag
gacaaggaccacccgctgttccaggacatccgctatctcggccgcctcctcggcgacgtg
ctgcgcgagcaggaaggcgacgccgtattcgacgtcgtcgaaacgatccggcagaacgcc
gtgcgcttccgtcgcgaggacgacagcgccgccgcgcagacgctcgacaaaaagctgcgc
tcgctgacgcccgagcagaccgtcagcgtcgtgcgcgcgttcagctacttttcgcatctc
gcgaacatcgccgaggaccgtcaccgcaaccgtcgtcaccgcattcacgcgctcgcgggc
tcggcctcgcagccgggcacgatcgcccatgcgctcgagcggctcgtcgcggccggtgcc
gccgcgacgccggtgctgcagcggtttttcgacgacgcgctgatcatgccggtgctgacc
gcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcgt
ctgctcgccgagcgcgaccagccgctgacgaaccgcgagcgcgcgcacaacgaagcgatg
ctgcgcgcacgcgtcacgtcgctgtggcaaacgcggatgctgcgcgacgcgcgtctgacg
gtcgccgacgaaatcgagaacgcgctgtcgtactatcgcagcaccttcctcgaagaactg
ccggcgctttacgccgacatcgaggaagcgctgaaggagcacggcctcgaagcgcgcctg
ccaccgttcttccagatgggcagctggatcggcggtgatcgcgacggcaatccgaacgtc
accgccgaaacgctcgaaaacgcgatcacgcgtcaagccgctgtgatcttcgagcactac
ctggtgcaggtgcacaagctcggcgaggagctgtcgatgtcgaatgtgctcgtcggcgtg
agcgatgcgctcaatgaactcgcggacatctcgcccgaccactcgccgcatcgcaccgac
gagccgtatcgtcgcgcgctgatcggcatctacacgcgactcgcggcgagcgcgcgcgtg
cgtctcggcgaaggcagcgttccgctgcgcagcgccggccgcggcgtcgcgccgattcgc
gcaaccccctatgacgacgccgccgacttcgtgcgcgacctgcacgtgctgatcgactcg
ctggccgagcatcacggcgcgccgctcgccgcgccgcgtctcgcgccgctcgcgcgcgcg
gccgaagtgttcggcttccatctcgcgagcatcgatctgcggcaaagctccgacatccac
gaagcggtgatcgccgagctgctcaagcgcgccggtgtcgaggacgactacgcgggcttg
tcggaagcgaacaagctgaaagtgctgctcgccgagctcgcgcagccgcgcgcgctgcgt
gtgccttacgctgagtactccgacctcgtgaagagtgagctcgcggtgctcgaggaagcc
cgcatcacgcgcgagaaattcggcgcgcgcgcggtgcgcaattacatcatttcgcatacg
gagaccgtcagcgatctggtcgaggtgatgctgctgcagaaggaaaccggcctgttgctc
ggacatctgggcgacgagcacgaccccgcgcgcgcgagcctgatggtgatcccgctgttc
gagacgatccccgatctgcgcaacgcgccgcacatcatgcgcgacctgatcgcgctgccg
ggcatcggcgcgctgatcgaacatcagggcaacgagcaggaagtgatgctgggctactcg
gacagcaacaaggacggcggcttcctgacgtcgaactgggagctgtatcgcgcggagctg
gcgctcgtgtcgctgttcaacgaacgcggcgtgacactgcgtctgttccatggacgcggc
ggcaccgtcggccgcggcggcggcccgacctaccaggcgatcctgtcgcagccgccgggc
accgtcgccggtcagatccgtttgaccgagcagggcgaggtgattgcgagcaagttcgcg
aatccggaaatcggccggcgcaatctggaaaccgtcgtggccgcgacgctcgaagcgtcg
ttgctgccgcacgaccacacgttggccgagctgcccgtgtacgaggaaacgatgcagcag
ctgtccgatacggcgatggccgcgtatcgcgcgctcgtctacgaaacgccgggcttcaag
gagtatttcttcgagtcgacgccgatcgcggagatcgccgagctgaacatcggcagccgc
cccgcttcgcgcaagctgcaggacccgaagcagcgcaagatcgaggatctgcgcgccatt
ccgtggggcttctcgtggggccaatgccggctgctgctgaccggctggtacggcttcggc
agcgcggtcaccgagcatctggacagcgcgccgtccgacgccgaacgcgcgcgccgtctc
gcgctgctgaagaagatgcacaagagctggccgttctttgcgaacctgatgtcgaacatg
gacatggtcatcgcgaagaccgacctcgcggtcgcgtcgcgttatgccgcgctcgtaacc
gacaagaagctgcgcaagcacgtgttcgagcgcatcgttgccgagtgggaacgcacgtcg
aaggtgttgtcggagatcaccggcaagagcgagcggctcgccgagaatccgctgctcgcg
cgctcgatcaagaaccgcttcccgtacctcgacccgctcaatcacctgcaggtcgaattg
ctcaaacgctatcgcgcgggcgacacgaatgcgcgcgtgcggcgcggcattcatttgtgc
atcaacgggatcgcggcggggttgcgcaataccggttga

DBGET integrated database retrieval system