KEGG   Burkholderia sp. CCGE1002: BC1002_2899Help
Entry
BC1002_2899       CDS       T01217                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bge  Burkholderia sp. CCGE1002
Brite
Translation factors [BR:bge03012]
 Eukaryotic Type
  Elongation factors
   BC1002_2899
 Prokaryotic Type
   BC1002_2899
Mitochondrial biogenesis [BR:bge03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BC1002_2899
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BC1002_2899
  Exosomal proteins of breast cancer cells
   BC1002_2899
  Exosomal proteins of colorectal cancer cells
   BC1002_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(3199530..3200720)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTQKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGSFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRATAKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
INPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggtaaattcgaacggaccaagccgcacgtgaacgtgggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcgatcacgacggttctgacgcagaagttt
ggcggcgaagcaaaggcgtacgaccagatcgacgcggcgccggaagaaaaggcacgcggc
attaccatcaacaccgcgcacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactacgtgaagaacatgatcacgggcgcggcacagatggac
ggcgcgatcctggtgtgctcggctgcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgagctgctggagctcgtcgagatggaagttcgcgaacttctgtcgaag
tacgacttcccgggtgacgacacgccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacc
tacatcccgacgccggagcgcgcggttgacggttcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgtggcacggtggtgacgggccgcgtcgagcgtggcgtgatcaag
gtcggcgaggaaatcgagatcgtcggtatccgcgcaacggccaagacgacctgcacgggc
gtggaaatgttccgcaagctgctcgaccagggtcaggcaggcgacaacgttggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggtcaggttctggccaagccgggttcg
atcaacccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcaacccgatcgcgatggaagaaggcctgcgattcgcaattcgc
gaaggcggtcgtacggtcggcgctggtgtcgtcgcaaagatcatcgagtaa

DBGET integrated database retrieval system