KEGG   Burkholderia sp. CCGE1003: BC1003_0917Help
Entry
BC1003_0917       CDS       T01314                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1003_0917
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_0917
   00680 Methane metabolism
    BC1003_0917
Enzymes [BR:bgf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BC1003_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(1042042..1045314)
Genome map
AA seq 1090 aa AA seqDB search
MTSSGSARSARRNTASPNASTADAGAFPASATIAADAASAGKVKRATSGAKAATASQAAK
AEKASNAATTTKALKAGKAGKTSLPVKADKAGKADKAGKAVKADNEDKALKMPKPGKSSE
AVPSTKKKGEAAGPTPALPAVSADAPPPAPKTNGRTRDDKDHPLFQDIRYLGRLLGDVLR
EQEGDEVFDVVETIRQTAVRFRREDDNAAAQTLDKKLRSLSPEQTVSVVRAFSYFSHLAN
IAEDRHRNRRHRIHALAGSAAQPGSIAYALERLVEAGAAATPVLQQFFNDALIVPVLTAH
PTEVQRKSILDAEHDVARLLAERDQQLTERERAHNETMLRARVTSLWQTRMLRDSRLTVA
DEIENALSYYRATFLEEIPALYADIEEALKEHGLEARLPPFFQMGSWIGGDRDGNPNVTA
ETLEHAIARQAEVIFEHYLEQVHKLGAELSVSNLLAGASDELKALADISPDRSPHRTDEP
YRRALIGMYTRLAASARVRLGEGSVPLRSAGRGAAPIRATPYDDASEFVRDLHVLIDSLA
AHHGAPLAAPRLAPLARAAEVFGFHLASIDLRQSSDIHEAVIAELLKRAGVHDDYAALSE
SEKLAVLLAELAQPRPLRLPYAEYSDLVKSELGVLEQARVTREKFGARAVRNYIISHTET
VSDLVEVMLLQKETGLLQGQLGNPNDPAKAALMVIPLFETIPDLRNAPHIMRDLLALPGA
DSIIEHQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNERGITLRLFHGRGGT
VGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPEIGRRNLETVVAATLEASLL
PHGNAPAELPAFEETMQQLSDAAMASYRALVYETPGFKEYFFESTPISEIAELNIGSRPA
SRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVGAYLDGAPSDTERARRLAL
LKKMHKSWPFFSTLLSNMDMVLAKTDLAVASRYAALVSDKKLRKHVFERIVAEWERTSKV
LSEISGKSERLAENPLLARSIKNRFPYLDPLNHLQVELLKRHRAGDTNARVRRGIHLTIN
GIAAGLRNTG
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttctggatcggcgcgctcagcccgccgcaacactgcatcgcccaacgcttcc
actgccgacgccggcgcgttcccggcttcggcaaccatcgcggccgacgccgcttcggct
ggcaaggtcaaacgcgcgacgtcgggcgcgaaggccgccacggcctctcaagccgccaag
gccgaaaaagccagcaacgccgctacaaccaccaaggccctgaaagccggcaaggcaggc
aaaacctccttgcccgtcaaagcggacaaagccggtaaagccgataaagcaggcaaagcg
gtcaaagccgataacgaagacaaagccctgaagatgccgaagccgggcaagtccagcgag
gcggttccttccacgaagaagaaaggcgaagccgccggccccacgccggccctgccagcc
gtctccgcggacgcgccgccccccgcgccgaaaaccaacggccgcacgcgcgacgacaag
gaccatccgctctttcaggacatccgctaccttggacggctgcttggcgacgtgctgcgc
gaacaggaaggcgacgaagtgttcgacgtcgtcgaaacgatccggcagacagccgtgcgc
tttcgccgcgaggacgacaacgccgccgcgcaaacgctcgacaaaaagctgcgctcgcta
agccccgaacaaacggtgagcgtggtgcgcgcgttcagctacttctcgcatctcgccaac
atcgccgaagaccgtcaccgcaatcgccgtcaccgcattcacgctctggccggctcggcc
gcgcagccgggcagcattgcctatgcgctggagagactggtcgaagcaggcgccgccgcg
acgccggtgctgcaacagttcttcaacgacgcgctgatcgtgcccgtgctgacggcgcac
cccaccgaggtgcagcgcaagagcattctcgacgccgagcacgacgtcgcgcgcctgctc
gccgagcgcgaccagcagttgaccgagcgcgaacgcgcgcacaacgaaaccatgttgcgc
gcacgcgtcacgtcgctctggcaaacgcgcatgctgcgcgattcgcgcctcaccgtggcc
gacgaaatcgagaacgcactgtcgtactaccgcgcgactttcctcgaggaaatccccgcg
ctctacgccgacatcgaagaagcgctgaaagagcacggcctcgaagcacgcctgccgccc
ttcttccagatgggcagctggatcggcggcgaccgcgacggtaatccgaacgtcaccgcc
gagacgctcgagcacgccattgcgcgccaggccgaggtgatcttcgagcactatctggag
caggtgcacaagctgggcgccgagttgtccgtatcgaatctgctcgcgggcgcaagcgac
gaactaaaagcgctcgccgacatttcgccggaccgctcgccgcatcgcacggacgagccg
taccggcgcgcgctgatcggcatgtacacgcggctcgcggcaagcgcacgggtgcgcctc
ggcgaaggcagcgtgccgctgcgcagcgcgggccgcggcgcagcgccgatccgcgcaacg
ccatatgacgacgcctcggagttcgtgcgcgacctgcacgtgctgatcgattcgctcgcc
gcgcaccacggtgcgccgcttgccgcgccgcgtcttgcgccgctcgcgcgcgcagcggaa
gtgttcggcttccatctggcgagcatcgacttgcgccaaagctcggacattcacgaagcg
gtgatcgcggaactgctcaagcgcgcgggcgtgcacgacgactacgcggcgctctccgaa
agcgagaagctcgcagtgctgctcgcggaactcgcgcagccgcgcccgctgcgcctgccg
tatgccgagtactcggatctcgtgaaaagcgagctcggcgtgctcgaacaggctcgcgtc
acgcgcgagaaattcggcgcgcgcgcggtgcgcaactacatcatttcgcacacggaaacg
gtcagcgatctggtggaagtaatgctgctgcaaaaagagaccggcctgctgcaaggacaa
ctcggcaatccgaacgatcctgccaaggcggcgctcatggtgatcccgctcttcgagacg
atccccgatctgcgcaacgcgccgcacatcatgcgcgatctgcttgcattgccgggcgcc
gactcgatcatcgagcaccagggcaacgagcaggaagtgatgctcggctattcggacagc
aacaaggacggcggcttcctcacgtcgaattgggagctgtaccgcgccgaactcgcgctc
gtctcgctcttcaacgagcgcggcatcacgctgcgcctgttccacggacgcggcggcacc
gtcggccgtggcggcggtcccacctatcaggcgattctgtcgcagccgcctggcacggtc
gacggccagatccgcctgaccgagcaaggcgaggtgatcgcaagcaagttcggcaatccg
gaaatcggccggcgcaatctggaaacggtggtcgcggcgacgctcgaagcgtcgctgctg
ccgcatggcaatgcgcccgccgagctgcccgcattcgaagagacgatgcagcagctttcc
gacgcggcgatggcctcgtaccgcgcgctcgtgtacgaaacgcccggtttcaaggagtat
ttcttcgagtcgacgccgatctcggagatcgcggaactgaacattggcagccgtccggcg
tcgcgcaaattgcaggacccgaagcatcgcaagatcgaagacctgcgcgcgattccttgg
ggcttctcgtggggccagtgccgcctgctgctgaccggatggtatggcttcggcagcgcg
gtcggcgcgtatctcgacggcgcgccgagcgacaccgaacgcgcacgccgccttgcgctg
ctcaagaagatgcacaagagctggccgttcttttcgacactgctctcgaacatggacatg
gtgctcgcgaagaccgaccttgcggtggcctcgcgctatgcggcgctcgtgtccgacaag
aagctgcgcaagcatgtgttcgagcggatcgtcgcggaatgggagcgcacttccaaggtc
ttgtcggagatcagcggcaagagcgagcggcttgcggaaaatccgctgctcgcgcgttcc
atcaagaaccgttttccgtatctggatccgctcaatcacctgcaggtcgaactgctcaaa
cgtcaccgtgcgggcgataccaacgcgcgcgtgcggcgcggaattcatttgaccatcaac
gggatcgcggcgggcttgcgcaatacgggctaa

DBGET integrated database retrieval system