KEGG   Burkholderia sp. CCGE1003: BC1003_1063Help
Entry
BC1003_1063       CDS       T01314                                 

Definition
(GenBank) benzoate-CoA ligase family
  KO
K04110  
benzoate-CoA ligase [EC:6.2.1.25]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Benzoate degradation
Aminobenzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1003_1063
   00627 Aminobenzoate degradation
    BC1003_1063
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.25  benzoate---CoA ligase
     BC1003_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(1214106..1215722)
Genome map
AA seq 538 aa AA seqDB search
MEALFEPAASQPAVTVEPPPARFNFAAHLFALNASRAGKTAYVDDNGRTSYGELDERARR
FATALRGLGVHPEERVLLVMLDSVALPTAFLGALYAGVVPVVANTLLTPADSVYMLTHSH
ARAVIASSALAANVMQAMEAAEHDGCQLIVSTRASATPDSTPDSAPLAAPVFEDLVDAAA
PAVKHAATGCDDIAFWLYSSGSTGKPKGTVHTHANLYWTAELYAKPVLGIVESDVVFSAA
KLFFAYGLGNALTFPLSVGATTVLMAERPTADAVFDRLTRHRPTVFYGVPTLYASMLVSP
KLPAREEVAMRVCTSAGEALPREIGERFTKHFGCEILDGIGSTEMLHIFLSNRAGAVEYG
TTGRPVPGYEVELRDERGHPVGDGEVGDLYIKGPSAALMYWCNREKSRATFLGEWIRSGD
KYRRLPNGCYVYAGRSDDMLKVSGQYVSPVEVEMVLVQHDAVLEAAVVGVDHGGLVKTRA
FVVLKREFAGSEILADELKAFVKDRLAPHKYPRDIVFVDDLPKTATGKIQRFKLRELS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggaagccctgttcgaaccggctgcaagccagcccgccgtgacggtcgagccgccgccc
gcgcgcttcaacttcgccgctcatctctttgcgttgaatgcgtcgcgcgccggcaagacc
gcgtatgtcgacgacaacggcaggacgagctatggcgaactggacgaacgcgcgcggcgc
tttgcgaccgcgttgcgcggtctgggcgtgcatcccgaagaacgggtgctgctggtgatg
ctggacagcgtggcgttgcccactgcatttcttggcgcgctctacgcaggcgtagtgccg
gtggtagccaacacgctgctcacgccagcggactctgtgtatatgctcacgcacagtcat
gcacgcgcggtgatcgcgtcgagcgcgcttgccgcaaatgtcatgcaggcgatggaagcg
gccgaacacgacggctgccagttgatcgtttcgacacgcgcgtcggccacgcctgacagt
acgcctgacagcgcgccgctcgcagcacccgtattcgaagacctcgtcgacgcggcggca
cccgccgtgaagcacgccgcgaccggttgcgacgacattgccttctggctgtattcatcg
ggctcgaccggcaagccgaaaggcaccgtgcatacccatgcgaacctctactggaccgcg
gagctgtatgcaaagccggtgcttggcattgtcgagagcgatgtggtgttttccgcggcg
aagcttttcttcgcctacggcctcggcaacgcgctgacctttccgctgtcggtgggcgcg
accaccgtgctgatggcggagcgccccacggccgatgccgtgttcgaccgcctcacgcgt
catcgcccgaccgttttctacggcgtgcccacgctctatgcaagcatgctcgtatcgccg
aagctgcccgcgcgcgaagaggtcgcgatgcgcgtgtgtacgtcggccggcgaagcattg
ccacgggaaattggcgagcgcttcacgaaacacttcggttgcgaaatactcgacggcatc
ggctcgaccgaaatgctccacatttttctgtccaatcgcgcgggcgccgtcgaatacggc
accacggggcgcccggtgccaggctatgaagtcgaactgcgcgacgaacgcggccatccg
gttggcgacggtgaagtgggcgacctctacatcaaaggacccagcgcagcgctcatgtac
tggtgcaaccgagagaaatcgcgcgccacctttctcggcgagtggattcgcagcggcgac
aagtaccgtcgtcttccgaacggctgctatgtgtacgcgggccgcagcgacgacatgctg
aaagtcagcggccaatatgtgtcgccggtcgaagtggaaatggtgctggtgcagcacgac
gcagtgctcgaagcggcggtggtcggcgtcgaccacggcggcctcgtgaagacgcgtgcg
ttcgtcgtattgaagcgcgagttcgcagggtctgagatactggcggacgaactcaaggct
ttcgtgaaggacaggctcgcgccgcataaatatccgcgcgacatcgtattcgtcgacgac
ttgccgaaaaccgccaccggcaagattcagcgcttcaaactgcgcgaactatcataa

DBGET integrated database retrieval system