KEGG   Burkholderia sp. CCGE1003: BC1003_2779Help
Entry
BC1003_2779       CDS       T01314                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BC1003_2779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(3255848..3256426)
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS
SGGVFNNAAQVWNHTFFWNSLSPQGGGAPTGALADAINAKWGSFDKFKEEFAKTAIGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVEAYWN
IVNWEFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatacgctcccgccgctgccgttcgcgaaaaacgcactcgctccgcacatgtcg
gaagagacgctcgagtttcactacggcaagcatcaccagacctatgtgaccaacctgaac
aatctgatcaagggcacggagttcgagaacctgtcgctcgaagaaatcgtgaagaagtcg
tcgggcggcgtgttcaataacgcagctcaggtgtggaaccacacgttcttctggaacagc
ctgtcgccgcaaggtggcggcgcaccgaccggcgcgctggcggatgcgatcaacgccaag
tggggctcgttcgacaagttcaaggaagagtttgcgaagaccgccatcggcacgttcggc
tcgggttgggcatggctcgtgaagaaggcagacggttcgctcgacctggtgtccacgagc
aacgcggccacgccgctcaccacggacgccaaggcgctgctgaccatcgatgtgtgggaa
cacgcgtactacatcgactatcgcaatgcacgtccgaagtttgtcgaggcgtactggaac
atcgtcaactgggaattcgcagcgaagaacttcgcgtaa

DBGET integrated database retrieval system