KEGG   Burkholderia glumae BGR1: bglu_1g10900Help
Entry
bglu_1g10900      CDS       T00905                                 

Definition
(GenBank) DNA primase small subunit
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    bglu_1g10900
Enzymes [BR:bgl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     bglu_1g10900
DNA repair and recombination proteins [BR:bgl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     bglu_1g10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1194578..1197295
Genome map
AA seq 905 aa AA seqDB search
MTDTLSEYQRKRRFDATPEPAGAKRRGAPARRRDGAAAPLRFVVQVHHARRLHYDFRLEL
DGVLKSWAVPKGPSPDPADKRLAIQVEDHPLDYASFEGEIPPGHYGAGSVRIDDAGVWRP
EGGVAGARRGYRDGKLTFELDGAKLRGRWSLTRTAMPGSRGKSSWLLVRAHEDAAGSEPA
DQAADQLVDQAAARRRTRQGRPAAKPAAKRPAKPAAAQPAASASGTATALPGARRAALPD
ALAPQLATLVAAPPEDEGWRYEMKFDGYRVLIRIAGRGGRRSVRVLTREGLDWSAKFGAQ
CAAFAALPVDDAWLDAEAVVLDARGVPDFAALQRALSDGDDAAIVCFVFDLLHLDGRALQ
AVPLDARRARLAALLAGADSGCLRFSPTLDGAPAALLEAAARAGLEGLIGKRADGAYRAG
RSRQWIKLKCRQRQEFVIGGYSAPRGSRSHFGALLLGVHAAPPRSTRRGGQAARERALQY
VGRVGTGFDAQQLAALAKRLAALERERAPFAVPPPSRGDAVRWVEPRLVAECEFAGWTRD
GLLRQAAFIALREDKPTARVVRETALPTAGRTTGGSMDSNEAASAGHAARRRRGGADEPV
EAGQARPAGAASVAGVRITHPERVVDAQGGFRKIDVVRYYESVARWLLPQLSGRPVSLVR
YMKGIGGESFFQKHAGARGMGFVTRHPGLDPGHDALMTLDDTAALVGAAQFDAIEFHTWN
ATVDRIERPERLVFDLDPDPALPWERMIEAAGLVRALLEALGLPAFCKTSGGKGLHVVVP
IVRHTEWDDAKAFSQAVARHLAGQLPERFTAKMGPENRRGLIFVDYLRNGRGASTVAAYS
ARARPGMGVSVPLAWEEVAATTGGAQWTIANLSARLDAQRADPWDGYDAARTRITAAMRK
RLGER
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctctccgagtatcaacgcaagcgccgcttcgacgcgacgcccgagccg
gccggcgcgaagcggcgcggggcgcccgcgcggcgtcgggacggcgccgccgcgccgctg
cgtttcgtcgtgcaggtgcatcacgcgcggcgtctgcattacgacttccgcctcgaactc
gacggcgtgctcaagtcgtgggccgtgccgaaaggcccgagccccgatccggccgacaag
cggctcgccattcaggtcgaggaccatccgctcgactatgcgagcttcgagggcgagatt
ccgcccggccactacggcgcgggcagcgtgcggatcgacgatgccggcgtctggcgccca
gaaggcggcgtggcgggtgcccggcgcggctaccgcgacggcaagctcacgttcgaactc
gacggcgcgaagctgcgcgggcgctggtcgctgacccgcaccgcgatgccgggcagccgt
ggcaagtcctcgtggctgctcgtgagagcgcatgaggacgcggccggcagcgagccggcg
gaccaagcggccgaccaactggtggaccaggcggcagcgcggcggcgcacgcggcagggc
cggccggccgcgaagcccgcggcgaagcgcccggccaagcccgcggccgcgcagccggcc
gcatcggcctcaggcaccgccaccgcgctccccggcgcccgccgcgcggccttgccggac
gcgctcgcgccgcaactggcgacgctggtcgccgcgccgcccgaggacgagggctggcgc
tacgagatgaagttcgacggctaccgcgtgctgatccgcatcgccggccgcggcgggcgc
cgctcggtgcgcgtgctgacgcgcgaagggctcgactggagcgcgaagttcggcgcgcag
tgcgccgcgttcgccgcgttgccggtcgacgatgcctggctcgacgccgaggccgtggtg
ctggacgcgcgcggcgtgcccgatttcgcggcactgcaacgggcgctgtcggacggcgac
gatgcggccatcgtctgcttcgtgttcgacctgctgcatctggacggccgcgcgctgcag
gcggtgccgctcgatgcgcgccgcgcgcggctggccgcgctgctggccggcgccgattcc
ggctgcctgcgcttctcgccgacgctcgacggcgcgccggcggcgctgctggaggccgcc
gcgcgggccgggctcgaaggcctgatcggcaagcgcgccgacggcgcctaccgcgccgga
cgcagtcgccaatggatcaagctcaaatgccggcagcgccaggaattcgtgatcggcggc
tacagcgcgccgcgcggcagccgcagccacttcggcgcgctgctgctcggcgtccacgcg
gcgccgccgcgctcgacgcggcgcggcggccaggccgcgcgcgagcgggccttgcagtat
gtcggccgggtcgggaccggcttcgatgcgcagcagctcgccgcgctggcgaagcggctc
gccgcgctcgagcgcgagcgcgcgccgttcgccgtgccgccgccttcgcgcggcgacgcg
gtgcgctgggtcgagccgaggctggtcgccgagtgcgagttcgcaggctggacccgtgac
gggctgctgcggcaggccgccttcatcgcgctgcgcgaggacaagccgaccgcgcgcgtc
gtcagggaaaccgccttgcctacggcggggcgaaccacgggaggcagcatggatagtaac
gaagcagcctcggccggccatgccgcgcgccgtcgtcgcggcggcgcggacgaaccggtc
gaggcaggccaggccaggccggccggcgcggcaagcgtggcgggagtgcgcatcacgcat
cccgagcgcgtcgtcgacgcgcagggcggctttcgcaagatcgacgtggtgcgctactac
gagtcggtggcgcgctggctgctgccgcaactgagcgggcggcccgtgtcgctggtgcgc
tatatgaagggcatcggcggcgaatcgttcttccagaagcacgcgggcgcgcgcggcatg
ggcttcgtcacgcgccacccggggctcgatccgggccacgacgcgctgatgacgctcgac
gacacggccgcgctggtgggcgccgcgcaattcgacgccatcgagtttcacacctggaac
gcgacggtggaccggatcgagcggcccgagcgcctggtgttcgatctcgatcccgatccg
gcgctgccgtgggagcggatgatcgaggcggccggcctagtgcgcgcgctgctcgaggcg
ctgggcctgccggcgttctgcaagaccagcggcggcaaggggctgcatgtggtggtgccg
atcgtgcggcataccgaatgggacgacgcgaaggcgttctcgcaggcggtggcgcggcat
ctggccgggcagctgccggagcgcttcaccgcgaagatggggccggagaatcgccgcggc
ctgatcttcgtcgactacctgcgcaacggccgcggcgcgagcacggtggccgcctattcg
gcgcgcgcgcggcccgggatgggcgtctcggtgccgctcgcctgggaggaggtggcggcc
accacgggcggcgcgcaatggacgatcgcgaacctgtcggcgcggctcgacgcgcagcgg
gccgacccgtgggacggctacgacgccgcacgcacgcgcatcacggcggcgatgcgcaag
cgcctcggcgagcgctga

DBGET integrated database retrieval system