KEGG   Burkholderia glumae BGR1: bglu_1g27940Help
Entry
bglu_1g27940      CDS       T00905                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_1g27940
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bglu_1g27940
   00680 Methane metabolism
    bglu_1g27940
Enzymes [BR:bgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     bglu_1g27940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3165924..3169019
Genome map
AA seq 1031 aa AA seqDB search
MKSSGSARAARRNAASSNVTAPATTDAPARQRGTTTAAQPAAQAATTKKPARPAANGDAT
PRKAGPTRPAATPGGTPARTGGATAAERPKPKANGRTRDDKDQPLFEDIRYLGRLLGDVV
REQEGEAVFEVVETIRQHAVKFRREDDREAAQALDKMLRKLTPEQTVSVVRAFSYFSHLA
NIAEDRHHNRRRRIHALAGSAPQAGTVAYALQALKAAGDASAEVIRRFFDEALIVPVLTA
HPTEVQRKSILDAQHDIARLLAERDQELTARERAHNDALLRARVASLWQTRMLRDARLTV
ADEIDNALSYYRATFLHELPALYADIEEALAEHGLAARVPAFFQMGSWIGGDRDGNPNVT
AATLEEAIHRQGAVILEHYLEQVHKLGAELSVSDLLVGASDEVRALAAASPDQSPHRVDE
PYRRALIGIYTRIAASARVRLGEGVVAVRSAGRGAPPVRATPYPDAEAFASDLRVLQDSL
VAHHGALLATPRLAPLVRAAETFGFHLASIDLRQSSDIHEAVIAELLARAGVEADYAALP
EADKLRVLLAALADPRPLRIPYVDYSELANSELGVLEKAREVRARFGPRAVRNYIISHTE
TVSDLVEVLLLQKETGLLDGTFGAGAADAKHSLMVIPLFETIADLRNAPEIMGDYFALPG
AAALVARQGGEQEVMLGYSDSNKDGGFLTSNWELYRAELALVELFRAHGIRLRLFHGRGG
TVGRGGGPTYEAILSQPPGTVNGQIRLTEQGEVIASKFSNPEIGRRNLETVVAATLEASL
LPRNNAPAQLPAFEAAVQTLSDVAIATYRALVYETPGFTDYFFSSTPINEIAELNIGSRP
ASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAFAAYLDGAGDEAERARRLA
LLQKMNRTWPFFSHLLSNMDMVLSKVDLAVASRYAELVADKKLRKHVFGRIVAEWERTTA
ALAAITGHEARLATNPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARVRRGIHLTI
NGIAAGLRNTG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctccggatcggcgcgcgctgcgcgccgcaatgctgcctcgtccaacgtcacc
gcgccggccacgaccgacgcccccgcgcgccagcgcggcacgaccacggccgcccaaccc
gccgcccaggcggcaaccacgaagaaaccggcaagaccggccgccaacggcgacgcgacg
ccccgcaaggccggcccgaccaggccggccgcgacacccggcggaacgccggcgcggacc
ggcggcgcgaccgcggccgagcggccgaagccgaaggccaacggccgcacgcgcgacgac
aaggatcagccgctgttcgaggacatccgctatctgggacgcctgctcggcgacgtggtg
cgcgagcaggaaggcgaggccgtgttcgaggtggtcgagacgatccgccagcacgccgtg
aagttccgccgcgaggacgatcgcgaggccgcgcaggcgctcgacaagatgctgcgcaag
ctcacgcccgagcagaccgtgagcgtggtgcgcgcattcagctacttctcgcatctggcc
aatatcgccgaggaccgccatcacaaccgccgccgccggattcatgcgctggccggctcc
gcgccgcaggcgggcaccgtggcctacgcgctgcaggcgctcaaggcggccggcgacgcg
tcggccgaggtgatccgccgcttcttcgacgaggcgctgatcgtgccggtgctgaccgcg
caccccaccgaagtgcagcgcaagagcatcctcgacgcccagcacgacatcgcgcggttg
ctggccgagcgcgaccaggagctgaccgcgcgcgagcgcgcccacaacgacgcgctgctg
cgcgcgcgggtcgcctcgctgtggcagacccgcatgctgcgcgacgcgcggctgacggtg
gccgacgagatcgacaacgcgctgtcctactaccgcgcgaccttcctgcacgagctgccg
gcgctctacgccgacatcgaggaggcgctcgccgaacacggcctggccgcgcgcgtgccg
gccttcttccagatgggcagctggatcggcggcgaccgcgacggcaatccgaacgtgacg
gccgccacgctcgaggaggcgatccaccgccagggcgccgtgatcctcgagcactacctg
gagcaggtccacaagctcggcgccgagctgtcggtgtcggacctgctggtgggcgcgagc
gacgaggtcagggcgctcgcggccgcctcgcccgaccagtcgccgcatcgcgtcgacgag
ccgtaccgccgcgcgctgatcggcatctacacgcgcatcgccgcgagcgcgcgggtgcgc
ctgggcgaaggcgtggtggcggtgcgcagcgccgggcgcggcgcgccgccggtgcgcgcg
acgccgtatccggacgccgaggcgttcgcgagcgacctgcgcgtgctgcaggactcgctc
gtcgcccatcacggcgcgctgctggcgacgccgcgcctcgcgccgctggtgcgcgcggcc
gagacgttcggcttccatctcgccagcatcgacctgcgccagagctcggacatccacgag
gccgtgatcgccgagctgctcgcgcgcgccggcgtcgaggccgactacgcggcgctgccc
gaagccgacaagctgcgcgtgctgctcgccgcgctggccgacccgcgcccgctgcggatt
ccctacgtcgactactccgagctggcgaacagcgaactcggcgtgctcgagaaggcccgc
gaggtacgcgcgcggttcggcccgcgcgcggtgcgcaactacatcatctcgcataccgag
acggtgtccgacctggtggaggtgctgctgctgcaaaaggagaccggcctgctcgacggc
accttcggcgccggggcggccgacgcgaagcattcgctgatggtgatccccttgttcgag
acgatcgccgacctgcgcaacgcgcccgagatcatgggcgactacttcgcgctgccgggc
gccgcggcgctcgtcgcgcgccagggcggggagcaggaggtgatgctcggctactcggac
agcaacaaggacggcggcttcctgacctcgaactgggagctgtaccgcgccgagctcgcg
ctggtcgagctgttccgcgcgcatggcatcaggctgcggctgttccatggccgcggcggc
acggtcggccgcggcggcggccccacctacgaggcgatcctctcgcagccgcccggcacc
gtgaacggccagatccgcctgaccgagcagggcgaggtgatcgcgagcaagttctcgaac
cccgagatcggccgccgcaacctcgaaacggtggtcgccgcgacgctcgaggcctcgctg
ctgccgcgcaacaacgcgcccgcgcagctgccggcgttcgaggccgccgtgcagacgctg
tcggacgtggcgatcgccacctatcgcgcgctcgtctacgagacgcccggcttcaccgat
tatttcttctcctcgacgccgatcaacgagatcgccgagctgaacatcggcagccggccg
gcctcgcgcaagctgcaggacccgaagcaccgcaagatcgaggacctgcgtgcgatcccg
tggggcttctcgtggggccagtgccggctgctgctgaccggctggtacggcttcggcagc
gccttcgcggcctacctcgacggcgccggggacgaagccgagcgcgccaggcgcctcgcg
ctgctgcagaagatgaaccgcacctggccgttcttctcgcacctgctctcgaacatggac
atggtgctctccaaggtcgatctggcggtggcctcgcgctatgcggaactcgtcgccgac
aagaagctgcgcaagcacgtgttcggccgcatcgtcgccgaatgggagcgcaccacggcc
gcgctcgccgcgatcaccggccacgaggcgcggctcgccaccaacccgctgctggcgcgc
tcgatcaagaaccgcttcccctacctcgatccgctgaaccacctgcaggtcgaactgatc
aagcgccaccgcgccggtgacaccaacgcgcgcgtgcggcgcgggatccatctgaccatc
aacggcatcgcggccggcctgcgcaataccggctga

DBGET integrated database retrieval system