KEGG   Burkholderia glumae PG1: BGL_1c07110Help
Entry
BGL_1c07110       CDS       T03632                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase Gad
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00250  Alanine, aspartate and glutamate metabolism
bgp00410  beta-Alanine metabolism
bgp00430  Taurine and hypotaurine metabolism
bgp00650  Butanoate metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
bgp02024  Quorum sensing
Module
bgp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bgp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BGL_1c07110 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BGL_1c07110 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BGL_1c07110 (gad)
   00430 Taurine and hypotaurine metabolism
    BGL_1c07110 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BGL_1c07110 (gad)
Enzymes [BR:bgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BGL_1c07110 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJK45246
UniProt: A0A0B6RZ20
LinkDB All DBs
Position
1:complement(814615..815958)
Genome map
AA seq 447 aa AA seqDB search
MKIELPEREINGELGGIYSAHVSQHPLPTLRIPDTSTAPAVAYNLIHDELLLDGNSQQNL
ATFCTTWVEPEVQQLMTDAIDKNMIDKDEYPQTAEIENRCVTMIADLWHAPDPLGTIGCS
TTGSSEACMLGGLALKWKWKQRREAAGLSTARPNFVCGPVQICWKKFARYFDVEIREAPL
HGDGLGITPADLRELCDENTIGVVATLGVTFTGIYEPVAALAAELDAMQRELGLDIPIHV
DAASGGFVAPFIQPDLEWDFSIERVKSINASGHKYGLAPLGVGWAVWRSKQELPEDLIFY
VDYLGGNMATFALNFSRPGGEIIAQYYNFLRLGREGYTGIQQACSDTAQWLAAEVARLGP
LELVYDGRGGLPAVCYRLKDGIHHRFTLYDLSDRMRMRGWQIASYPLPANRQDVIVQRVL
IRHGISRDLIKILLDDLHKAIEYLQGN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaattacccgagcgagagatcaatggcgaactaggcggcatttattcggcg
cacgtgtcgcagcatccgctgccgacgcttcggattcctgacacttcgacggccccggcg
gtggcctacaacctgatccacgacgagttgctgctcgacggcaactcgcaacagaacctg
gcgacgttctgcaccacctgggtcgagccggaagtgcagcagttgatgaccgatgccatc
gacaagaacatgatcgacaaggacgagtatccgcaaacggccgagatcgagaaccgctgc
gtcacgatgatcgccgacctgtggcacgcgcccgatccgctcggcacgatcggctgctcc
accaccggctcgagcgaagcctgcatgctgggcggcctcgcgctgaaatggaaatggaaa
cagcgccgcgaggcggccgggctttcgacggccaggcccaatttcgtgtgcggcccggtg
cagatctgctggaagaagttcgcgcgctacttcgacgtcgagatccgcgaggcgccactg
cacggcgacggcctcggcatcacgccggccgacctgcgcgagctgtgcgacgagaacacc
atcggcgtggtcgcgacgctcggcgtcaccttcaccggcatctacgagccggtcgcggcg
ctcgccgccgagctcgacgcgatgcagcgcgaactcgggctcgacatcccgatccacgtc
gacgcggccagcggcggcttcgtcgccccgttcatccagcccgacctcgaatgggacttc
tcgatcgaacgcgtcaagtcgatcaacgcgtccgggcacaagtacggcctggcgccgctc
ggggtgggctgggccgtctggcgctcgaagcaggaactgccggaagacctgatcttctac
gtcgattacctcggcggcaacatggcgaccttcgcgctgaacttcagccgtccgggcggc
gaaatcatcgcgcagtactacaacttcctgcggctcggccgggaaggctacacgggcatc
cagcaggcctgcagcgacacggcccagtggctggccgccgaagtggccaggctcggaccg
ctcgaactcgtctacgacggccgcggcggcctgccggccgtctgctatcgcctgaaggac
ggcatccaccatcgcttcacgctctacgacctctccgaccgcatgcgcatgcgcggctgg
cagatcgcctcctatccgctgccggccaaccgccaggacgtgatcgtgcaacgcgtcctg
atacgccacggcatcagccgcgacctgatcaagatcctgctcgatgacctgcataaagcc
attgaatatcttcaaggcaactga

DBGET integrated database retrieval system