KEGG   Bartonella grahamii: Bgr_04980Help
Entry
Bgr_04980         CDS       T00922                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bgr  Bartonella grahamii
Brite
Enzymes [BR:bgr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bgr_04980 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(604403..605005)
Genome map
AA seq 200 aa AA seqDB search
MAFELPPLPYDYDALSPYMSRETLEYHHDKHHLAYLNNTNNFVKELGLENESLEDIVKKS
FGKNIGLFNNAAQYYNHNHFWLWMKKDGGGQKLPEKLAKAIDADLGGYDKFRADFIAAAS
AQFGSGWAWVAVKDGKLEIMKTPNGENPLIHNARPILGVDVWEHSYYIDYRNARPKYLES
FVDHLINWDYVLKLYEECEF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgcccccgttgccttatgattacgatgccctttcaccttatatgtca
cgcgaaacgcttgaatatcatcatgataagcatcacctcgcttatcttaacaataccaat
aattttgtgaaggagttaggcttagaaaatgaaagccttgaagatattgttaaaaaaagt
tttggaaaaaatattggtttgtttaataatgcagcacagtattacaatcataaccacttt
tggctttggatgaaaaaagatggtggtggtcaaaaacttcctgaaaagttagcaaaagct
attgacgctgatctaggtggttacgacaaattccgcgctgattttattgctgctgctagt
gcccaatttggttctggatgggcatgggttgctgttaaagatggcaagcttgaaattatg
aaaacgcctaatggcgaaaatcccttaattcacaatgcccgacctattttgggtgtcgat
gtgtgggaacattcctattacattgattatcgcaatgctcgaccgaagtacctcgaatcc
tttgtagaccatttaattaattgggactatgttttgaaactttatgaagaatgtgaattt
taa

DBGET integrated database retrieval system