KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_1395Help
Entry
KS03_1395         CDS       T03820                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    KS03_1395
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KS03_1395
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    KS03_1395
Enzymes [BR:bgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KS03_1395
Peptidoglycan biosynthesis and degradation proteins [BR:bgu01011]
 Precursor biosynthesis
  Amino acid ligase
   KS03_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:1511802..1512743
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLFGGVSAEREVSLNSGRLVLQGLREAGIDAHLFDPSERPLSALKDE
GFVRAFNALHGGYGENGQLQGALDFYGIRYTGPGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDHAARAAEIVAKLGLPLFVKPASEGSSVAVIKVKDAAALPAALDEAGRHDRI
VIVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYLADDTQYLIPCGIEAAKET
EFKRLARRAFEVLGCSGWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLDD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtactgttcggcggcgtgtcc
gccgagcgcgaggtgtcgctgaattcgggccggctggtgctgcagggtctgcgcgaggcg
ggcatcgacgcgcatctgttcgatccgtccgagcggccgctgtcggcgctgaaggacgag
ggcttcgtgcgcgcgttcaacgcgctgcacggcggttacggcgagaacggccagctccag
ggcgcgctcgatttctacgggatccgctataccggccccggcgtgctcggctcggcactc
ggcctcgacaagttccgcaccaagctggtctggcagcagaccggcatcccgacgccgccg
ttcgagaccgtgatgcgcggtgacgaccacgccgcgcgcgcggcggagatcgtcgcgaag
ctgggcctgccgctgttcgtgaagccggcgagcgagggctcgagcgtcgccgtgatcaag
gtgaaggacgccgccgcgctgccggccgcgctcgacgaggcgggccggcacgaccggatc
gtgatcgtcgagaagagcatcgaaggcggcggcgagtacacggcctgcatcgcgggcgac
ctcgatctgccggtgatccgcatcgtgccggcgggcgagttctacgactatcacgcgaag
tacctcgccgacgacacgcagtacctgatcccatgcgggatcgaggcggctaaggaaacg
gaattcaagcggctcgcgcgccgtgcgttcgaggtgctcggctgcagcggctggggccgc
gccgatttcatgctcgacgcggcgggcaacccgtatttcctggaagtgaacacggcgccg
gggatgaccgaccactcgctgccgccgaaggccgcgcgcgcggtgggcatcagctactcg
gagctggtggtgaaggtgttgtcgctgacgctggacgactga

DBGET integrated database retrieval system