KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_390Help
Entry
KS03_390          CDS       T03820                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    KS03_390 (kynU)
Enzymes [BR:bgu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     KS03_390 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:412070..413320
Genome map
AA seq 416 aa AA seqDB search
MNSREDALALDRDDPLAALRGRFLLPDDTIYLDGNSLGARPAAAAARAQAVIADEWGRDL
IRSWNTAGWFALPRRLGDRLAPLIGAASGEVTITDTISVNLFKLLSAMLREQAKRAPERR
VIVSERSNFPTDLYIAQGLIAQLDRGYTLRLVDDPAELEAAIDAQTAVAMITHVNYRTGY
LHDMPAVTRHAQQAGALMLWDLAHSAGAVPVDLNGAGADGAVGCTYKYLNGGPGSPAFVW
VPQRHLAQFEQPLSGWWGHRAPFAMEPGFAPDAGIARFQCGTQPIVSMAMVECGLDIFHE
TDMQTIRRKSLALSDAFIALVERRCAGLDLTLVTPREHARRGSQVSFEHPHGYEVMRALI
ARGVIGDYREPRILRFGFTPLYTRYADVWDAVEVLREILETRAWQAPEFAARTAVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacgtgaagacgcactcgcgctcgatcgcgacgaccccctcgccgccctgcgc
ggccgcttcctgctgcccgacgacacgatctacctcgacggcaactcgctcggcgcgcgg
ccggccgctgcagccgcgcgcgcgcaggccgtgatcgccgacgaatggggccgcgacctg
atccgcagctggaacaccgcgggctggttcgcactgccgcgccgcctcggcgaccgcctc
gccccgctgatcggcgcggcgagcggcgaggtgacgatcaccgacacgatctcggtgaac
ctgttcaagctgctctcggcgatgctgcgcgagcaggccaagcgcgcgcccgaacgccgc
gtgatcgtctccgagcgctcgaacttcccgaccgatctctacatcgcgcagggcctcatc
gcccagctcgatcgcggctacacgctgcgcctcgtcgacgatccggccgaactcgaagcg
gcgatcgacgcgcagacggccgtggccatgatcacgcacgtgaactaccgcaccggctac
ctgcacgacatgccggccgtcacgcgccacgcgcagcaggccggcgcgctgatgctgtgg
gatctcgcgcattcggccggcgcggtgccggtcgacctgaacggcgccggcgcggacggc
gcggtcggctgcacctacaagtacctgaacggcggccccggctcgccggccttcgtctgg
gtgccgcagcgccacctcgcgcagttcgagcagccgctctcgggatggtggggccaccgc
gcgccgttcgcgatggagcccggcttcgcgcccgacgccggcatcgcgcgcttccagtgc
ggcactcagccgatcgtctcgatggcgatggtggagtgcgggctcgacatcttccacgag
accgacatgcaaacgatccgccgcaagtcgctcgcgctctccgatgccttcatcgcgctc
gtcgagcgccgctgcgccgggctcgacctgacgctcgtcacgccgcgcgagcatgcgcga
cgcggctcgcaggtcagcttcgagcacccgcacggctacgaggtgatgcgcgcgctgatc
gcgcgcggcgtgatcggcgactaccgcgagccgcgcatcctgcgcttcggcttcacgccg
ctctacacgcgctacgcggatgtctgggacgccgtggaggtgctgcgcgagatcctcgag
acccgggcctggcaggcgcccgaattcgccgcgcgaaccgccgtgacctga

DBGET integrated database retrieval system