KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5192Help
Entry
KS03_5192         CDS       T03820                                 

Definition
(GenBank) DNA ligase, ATP-dependent, family
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu03030  DNA replication
bgu03410  Base excision repair
bgu03420  Nucleotide excision repair
bgu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bgu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KS03_5192
   03410 Base excision repair
    KS03_5192
   03420 Nucleotide excision repair
    KS03_5192
   03430 Mismatch repair
    KS03_5192
Enzymes [BR:bgu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KS03_5192
    6.5.1.6  DNA ligase (ATP or NAD+)
     KS03_5192
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     KS03_5192
DNA replication proteins [BR:bgu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    KS03_5192
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     KS03_5192
DNA repair and recombination proteins [BR:bgu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     KS03_5192
   NER (nucleotide excision repair)
    Other NER factors
     KS03_5192
   MMR (mismatch exicision repair)
    Other MMR factors
     KS03_5192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AJY64815
LinkDB All DBs
Position
II:complement(2322455..2324122)
Genome map
AA seq 555 aa AA seqDB search
MKRFATLYAALDATTSTNVKLEALIAYFASAAPEDAAWASYFLAGGKPRQTVPTRVLAEA
ARERAGLPAWLFEESYQAVGDLAETIAHVLPPPARESALGLAQWIEQRVLGLRGLDAAAL
RERLAGYWDELDWSERFLLTKLIGGGFRVGVSRQLVVRALAQVAGVDHKRIAQRMVGWTD
SRQTPSAARYLRLIAPAGDGDDPARPHESDLGLPYPFFLAHPLQADPATLGPVEDWIVEW
KWDGIRAQLVKRAGRVWLWSRGEDLVTERFPELAALGEALPDGTVIDGEILAWEPGAAAP
LPFARLQPRITRKSLTRKVLADSPAALLAYDLLEAEGRDLRAVPLATRRTRLEALAAALS
RTLAVDLLRVSPRVTADGWPALAARRAESRARGVEGLMLKAAASEYGVGRTKASGVWWKW
KIEPYAIDAVLLYAQRGHGRRASLYTDFTFAVWDEAGGVRTLVPFAKAYSGLTDEEMRQV
DAVVRKTTIEKFGPVRSVTPTLVFEIGFEGIQASPRHKSGIAVRFPRMLRWRTDKSIDEA
DTLEMLKGFLNGAPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttcgcgacgctctacgccgcgctcgacgcgaccacctccaccaacgtcaag
ctcgaggcgctgatcgcctatttcgcgagcgccgcgcccgaggatgcggcctgggcctcg
tatttcctcgcgggcggcaagccgcgccagaccgtgcccacgcgcgtgctggccgaggcc
gcgcgcgagcgcgccggcctgccggcctggttgttcgaggagtcgtaccaggcggtgggc
gacctggccgagacgatcgcccacgtgctgccgccgcccgcgcgcgaatcggcgctgggg
ctcgcgcagtggatcgagcagcgcgtgctgggcctgcgcggcctcgatgccgcggcgctg
cgcgagcgcctggccggctactgggacgaactcgactggagcgagcgcttcctgctcacc
aagctgatcggcggcggcttccgggtgggcgtgtcgcgccagctggtggtgcgcgcgctc
gcgcaggtggcgggcgtcgatcacaagcgcatcgcgcagcgcatggtcggctggaccgat
tcgcgccagacgccgagcgccgcgcgttatctgcggctgatcgcgccggccggcgacggc
gacgatccggcgaggccgcacgaaagcgacctcggcctgccgtatccgttcttcctcgcc
cacccgctgcaggccgatccggccacgctcgggccggtcgaggactggatcgtcgaatgg
aagtgggacggcattcgcgcccagctcgtcaagcgcgcgggccgcgtctggctctggtcg
cgcggcgaggacctcgtgaccgagcgttttccggagctggccgcgctcggcgaggcactg
cccgacggcaccgtgatcgacggcgagattctcgcctgggagccgggcgccgctgcgccg
ctgccgttcgcgcgcctgcagccgcgcatcacgcgcaagtccctgaccaggaaggtgctg
gccgattccccggcggcgctgctcgcctacgacctgctcgaagccgagggccgcgacctg
cgcgccgtgccgctcgcgacgcggcgcacgcggctcgaggcgctggccgcggcgctctcg
cgcacgctcgccgtcgatctgctgcgggtctcgccgcgcgtgacggcggacggctggccg
gcgctcgccgcgcggcgcgccgagagccgcgcgcgcggcgtggaagggctgatgctgaag
gcggcggcgtcggagtacggcgtcggccgcaccaaggcctccggggtctggtggaagtgg
aagatcgagccgtatgcgatcgacgcggtgctgctctacgcgcagcgcggccacggccgg
cgcgcgagcctctataccgacttcacgttcgcggtgtgggacgaggccggcggcgtgcgt
accctcgtgccgttcgccaaggcctattccgggctgaccgacgaggagatgcgccaggtg
gacgcggtggtgcgcaagaccaccatcgagaagttcggcccggtgcgcagcgtcacgccc
acgctggtgttcgagatcggcttcgaaggcatccaggcgagcccgcgccacaagtcgggc
atcgccgtgcggttcccgcgcatgctgcgctggcgcaccgacaagtcgatcgacgaggcg
gacacgctggagatgctcaagggctttctgaacggagcgccggcatga

DBGET integrated database retrieval system