KEGG   Bacillus halodurans: BH3164Help
Entry
BH3164            CDS       T00039                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00030  Pentose phosphate pathway
bha00051  Fructose and mannose metabolism
bha00052  Galactose metabolism
bha00680  Methane metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
bha01230  Biosynthesis of amino acids
bha03018  RNA degradation
Module
bha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH3164 (pfk)
   00030 Pentose phosphate pathway
    BH3164 (pfk)
   00051 Fructose and mannose metabolism
    BH3164 (pfk)
   00052 Galactose metabolism
    BH3164 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BH3164 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BH3164 (pfk)
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BH3164 (pfk)
Protein phosphatases and associated proteins [BR:bha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BH3164 (pfk)
Messenger RNA biogenesis [BR:bha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BH3164 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: BAB06883
UniProt: Q9K843
LinkDB All DBs
Position
complement(3281774..3282733)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYQGYAGLISGDIRKMELGSVGDI
IHRGGTILYTARCEEFKTLEGQKKGIEQLKKFGIEGLVVIGGDGSFAGAQKLTEHGFPTV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHDRTYVIEVMGRNAGDLALWS
GLADGAETIVIPEADHDIDQIISRLQRGQERGKKHSIIVVAEGVGSGMDFGREISERTGA
ETRVTVLGHIQRGGSPTGFDRVLASRLGAKAVDLLLEGQAGVTVGIENNKLVHHDITEVL
QRKHSIDLDMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattggagtgttaacgagtggaggggactctcctggcatgaatgccgccatc
cgtgcggttgtacgtaaggcgatctatcacggagtagaggtttatggcatttaccaaggg
tatgctggtttaatttcaggagatattcgaaaaatggagcttggttctgtaggtgatatt
atccatcgcggggggaccattttatatacggcccgttgtgaagaattcaagacacttgaa
gggcaaaaaaagggaattgagcaactgaagaaatttggcatcgaaggcctagttgttatc
ggtggggatggttcatttgcaggtgcgcaaaaattaacggagcacggattcccaacagtg
ggagtgccaggaacgatcgataacgatatccctggaacagactttacaattggttttgac
acagctttgaatacggttattgatgcgattgataaaattcgcgatacagcaacatcgcat
gatcgtacatatgtcatcgaggtcatgggacgtaatgccggtgatttagcgctttggtct
ggcttagcagatggagcagaaaccattgtgattcccgaagctgatcatgatattgaccaa
atcatttcccgtctgcaacgaggacaagagcgagggaaaaaacatagtataatcgtcgtt
gctgaaggtgtaggaagtggaatggacttcggaagagaaatttcagaacgaacaggggct
gagacaagggtcaccgtgctcggacacattcaacggggaggctcaccaacaggatttgat
cgtgttctcgcgagtcgtcttggagcgaaagcggtagacttgcttttagaaggacaagca
ggtgtaacggtcgggattgaaaataataagcttgtccatcatgacattacagaagtattg
caacgtaagcattcgattgatttggatatgtatcgtttgtcacaggaactgtccatttaa

DBGET integrated database retrieval system