KEGG   Bordetella hinzii: ACR54_02134Help
Entry
ACR54_02134       CDS       T04004                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bhz  Bordetella hinzii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACR54_02134 (glpD)
Enzymes [BR:bhz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACR54_02134 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2201708..2203288)
Genome map
AA seq 526 aa AA seqDB search
MPSRADLLARLETSEPWDVVIIGGGATGLGTAVDAASRGFRTLLIEGADFAKGTSSKATK
LVHGGVRYLAQGNISLVREALHERGLLNRNAPHLAWPLGFVVPAYSLLDQPFYGVGLKMY
DMLAGALNLAPSRWLSRDETLAHARTLAPAVKGKRLRGGVLYYDGQFDDARLAISLMRTL
FDQGGTAINYVRVTGLSRDAQGRVDGVQTEDVIGGARHAIRGKCIVNATGVWVDAVRRMD
DPAAQTMVAPSQGVHLTLPRDFLPGDEAILVPKTDDGRVLFMVPWNGHTIVGTTDTARQD
LPADPRPLPGEVEFILETAGRYLTRQPTRADVTSVWAGLRPLVKATGEASTKSLSREHTI
LVSKSGLITVTGGKWTTYRKMAQDVVDTAIEKQLLPQAACRSADLRLHGAPAPGTRLAEP
QGTPDSYYGTDLPALRALPGADRMLVKASGLTEAHVRYAARHEMARTVEDVLARRNRALF
LDAEAAQLAAPEVARLLAQELGHDAAWQQRTLADFEAVAATFRLPA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcgcgcagatcttctcgcccgcctggaaacctccgaaccctgggacgtggtc
atcatcggcggcggcgccacgggcctgggcaccgccgtggacgccgcctcacgcggattc
cgcaccctgctcatcgagggcgcggacttcgccaagggcacgtccagcaaggccaccaag
ctcgtgcatggcggcgtgcgctacctggcgcagggcaacatcagcctggtgcgcgaggcg
ctgcacgaacgcggcctgctcaaccgcaatgcgccccacctggcgtggccgctgggtttc
gtggtgccggcctattcgctgctggaccagcctttctatggcgtcggcctgaagatgtac
gacatgctggccggcgcgctcaacctggcgcccagccgctggctgtcgcgcgatgagacg
ctggcccatgcccgcacgctggcgcccgcggtcaagggcaagcggctgcgcggcggcgtg
ctgtactacgacggccagttcgacgacgcgcgcctggccatctcgctcatgcgcacgctc
tttgaccaaggcggcacggccatcaactatgtgcgcgtcaccggcctgagccgcgatgcg
caaggccgcgtcgacggcgtgcagaccgaggacgtcatcggcggggcgcgccatgccata
cgcggcaagtgcatcgtcaacgccaccggcgtgtgggtcgacgcggtgcgccgcatggac
gacccggccgcgcagaccatggtggcgcccagccagggcgtgcacctgacattgccgcgc
gacttcctgcccggcgacgaagccatcctggtgcccaagaccgacgacggccgcgtgctc
ttcatggtgccctggaacggccacaccatcgtcggcaccaccgacactgcgcgccaggac
ctgcccgccgacccgcgcccgctgccgggcgaggtggagttcatcctcgagacagcgggg
cgctatctcacgcgccagcccacgcgcgccgacgtcaccagtgtgtgggccgggctgcgg
ccgctggtcaaggccacgggcgaagcgtcgaccaaatcgctatcgcgcgagcacaccatc
ctggtctccaagagcggcctgatcaccgtgaccggcggcaagtggaccacttaccgcaag
atggcccaggacgtagtggacaccgccatcgaaaaacaactgctgccccaggccgcctgt
cgcagcgccgacctgcgcctgcacggcgcgcccgcgcccggcacccgcctggccgagccc
cagggcacgcccgacagctattacggcaccgacctgccggccttgcgcgccctgcccggg
gccgatcgcatgctggtcaaggccagcggcctgaccgaagcgcatgtgcggtacgcggcg
cgccatgagatggcgcgcacggtcgaggatgtgctggcgcgccgcaaccgggcgctgttc
ctggatgccgaagccgcgcagctggccgcgcccgaggtggcccgcctgctggcccaggaa
ctgggccatgacgcggcctggcaacagcgcacgctggccgacttcgaggccgtggcggcg
accttccgcctgcccgcctga

DBGET integrated database retrieval system