KEGG   Bradyrhizobium icense: LMTR13_28515Help
Entry
LMTR13_28515      CDS       T04485                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bic  Bradyrhizobium icense
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bic00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMTR13_28515
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LMTR13_28515
   00680 Methane metabolism
    LMTR13_28515
Enzymes [BR:bic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LMTR13_28515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6106046..6108838)
Genome map
AA seq 930 aa AA seqDB search
MSSQTMPSEIEIRFNRTDESLALEEDARLRTDIRLLGRILGDTVRDQEGADVFDLVERIR
QTSIRFHRDEDKLARRELETILDSMSISDTVRIVRAFSYFSHLANIAEDQNNIRQMRGRG
PGGPRASALTQTLAHAKAAGISAVELRRFFKGAQVSPVLTAHPTEVRRKSTFDREMEIAA
LLDRRERVQLTPEEAEACDEQLRRAVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFLHE
VPRLHSALEDRLNQEEGGTPGELASFLTMGSWIGGDRDGNPFVTADVMRGTLRLQSSRVM
SFYLEELHVLGSELSLAAHLADISDELRALAERSPDTSPHRSGEPYRLAVSGIYARLTAT
AAKLEVETTRRPVGEAAPYASVKEFKADLDVLDRSLIANNSGVIARGRLRLLRRAVDCFG
FHLARLDIRQNSAVHERTVAELFDAAIPGMSYLALNEEARVHLLLRELRSARPLSSVFVK
YSEETLGELAMFRAAAEAHARFGPDVIHQCIISMCKGMSDMLEVAVLLKEVGLVNPSGRS
AINIVPLFETIEDLQASSGIMNRMLALHDYRRLVDSRGGIQEVMLGYSDSNKDGGFVTSG
WELYKAEIELVDVFERHGLRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQG
EIISSKYSNPEVGRSNLEILAAATLEASLLHPRQSAPRKEYLTAMEQLSALAFKAYRGLV
YETEGFADYFWGSTVITEISTLNIGSRPASRKKTREIEDLRAIPWVFSWAQCRLMLPGWY
GFGSAVEIWIAEHPEQGMPFLQELYREWPFFRTLLSNMDMVLAKSSIAIASRYAELVPDV
KLRESIFGRIRREWHSSIESLLDIMGHERLLQGNPLLERSIRNRFPYLDPLNHVQVELLK
EHRSHNPDEQVLRGIQLTINGISAGLRNSG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccagaccatgccttccgagatcgagatccggttcaaccgtaccgatgaatcg
ttggcgttggaggaggatgcgcggctgcggaccgacattcgcctgctcgggcggattctc
ggcgataccgtccgcgatcaggaaggcgctgacgtcttcgatctggtcgaacgtatcagg
cagacctcgatccggttccatcgcgacgaggacaagctggcgcggcgcgaactcgagacc
atcctcgacagcatgtcgatcagcgacaccgtgcggatcgttcgcgccttcagctatttc
tcccatctcgccaatatcgccgaggaccagaacaacatccgccagatgcgcgggcgtggt
cccggcgggccgcgggcgagcgcgctgacccagacgctggcgcatgccaaggcggcgggg
atcagtgcggtcgagctgcggcgattctttaagggcgcccaagtcagcccggtcctgacc
gcgcatccgaccgaggtccgccgcaagagcacattcgaccgtgagatggagatcgccgca
ctgctcgaccggcgcgaacgcgttcagctcacgccggaggaggccgaggcctgcgatgag
cagttgcgccgcgctgtgctgacgctgtggcagaccaatctgctgcggcggaccaagctg
accgtgctcgacgaagtcgccaacggcctgtcattctacgactacaccttcctccatgaa
gtgccgcggctgcatagcgcgctggaagaccggctgaaccaggaggagggcggtacgccc
ggcgagctggcgtcgttcctgaccatgggaagctggatcggcggcgaccgcgacggcaac
ccctttgtcaccgccgacgtcatgcgcggcacgctgcgcctgcagtcgagccgggtgatg
agcttctatctggaggaattgcacgttctcggctcggaactgtcgttggcggcgcacctt
gccgacatttcggacgagttgcgcgcgctggccgagcgctcgccggatacttcgccgcac
aggagcggcgaaccgtatcggctggcagtatcgggcatctatgcaaggttgaccgcgacc
gctgcaaagctcgaggtcgagacgacgcgtcgtccggttggcgaggccgcgccttatgca
agcgtgaaggagttcaaggccgatctcgacgtgctggatcgatcgctgattgcgaacaat
tcgggcgtgatcgcgcggggacggttgcgcttgctacgtcgtgccgtggattgcttcggc
tttcatctggcccgacttgacatcaggcagaattccgcggtgcacgagcgcacggtcgcg
gaactgtttgatgccgccatccccggcatgtcctatctggcactgaacgaggaggcccgc
gtccatctgctgctgcgcgagctgcgcagtgcaaggccgctgagctcggtgttcgtcaag
tacagcgaagaaacactcggcgaactcgccatgttccgcgccgccgccgaagctcatgcg
cgcttcggccccgacgtgatccaccaatgcatcatctccatgtgcaaggggatgtcggac
atgctggaggtggcggtgctgttgaaggaggtcggcctcgtcaatccttccggccgcagc
gccatcaacatcgtgccgctgttcgagaccatcgaggatctgcaggcctcatccggcatc
atgaaccggatgctggcgctgcacgattaccgccggctggtcgacagccgcggcggcatc
caggaagtgatgctgggctattccgacagcaacaaggacggcggcttcgtcacctcgggc
tgggagctctacaaggccgaaatcgagctggtcgatgtgttcgagcgccacggcctgcgc
ttgcggctgtttcacggccgcggcggatcggtcggccgcggcggcgggccgagctatgac
gccatcattgcgcagccgggaggtgcggtaaacggacagatccgcatcaccgagcagggc
gaaatcatctccagcaaatattccaacccggaggtcggccgcagcaatttggaaatcctc
gccgcggccacgctggaggcgagcctgttgcatccccggcagagcgcgccgcgaaaagaa
tatctgaccgcgatggagcaattgtcggcgttggcattcaaggcctatcgcgggttggtc
tatgagaccgaaggctttgccgattacttctggggctccacggtcatcaccgaaatctcg
acgctcaacatcggcagccgcccggcgtcgcgcaagaagacccgcgagatcgaggacctc
cgcgccatcccctgggtgttcagttgggcgcaatgccggctgatgctgccgggctggtac
ggtttcggctcggcggtcgagatctggatcgcggagcatccggagcagggcatgccgttc
ttgcaggagctctaccgcgaatggccgttcttccgcacgctgctgtccaacatggacatg
gtgctggccaagagttcgattgcgatcgcctcgcgctatgccgaattggtgcctgacgtg
aagttgcgcgagagcatctttgggcgcatccggcgcgaatggcattcctccattgagagc
ctgctcgatatcatgggacatgaacggctgctgcagggtaacccgctgctggaacgctcg
atccgcaaccgctttccctatctcgatccgctcaaccacgtgcaggtagagctattgaag
gagcatcgctcgcataatccggacgagcaggtgctgcgcgggattcagcttaccatcaac
gggatatcggcggggttgcgaaacagcgggtga

DBGET integrated database retrieval system