KEGG   Bacillus infantis: N288_01430Help
Entry
N288_01430        CDS       T02860                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bif  Bacillus infantis
Pathway
bif00473  D-Alanine metabolism
bif00550  Peptidoglycan biosynthesis
bif01100  Metabolic pathways
bif01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    N288_01430 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N288_01430 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    N288_01430 (ddl)
Enzymes [BR:bif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N288_01430 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bif01011]
 Precursor biosynthesis
  Amino acid ligase
   N288_01430 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGX02272
UniProt: U5L6L4
LinkDB All DBs
Position
242549..243622
Genome map
AA seq 357 aa AA seqDB search
MKKKLGLLYGGKSAEHKVSMQTALAVIKALDLEKFDIYPVYITEEGEWVKGPMLEAPAES
VKQLEFSQGEAMSPAALAPAMFKSAEESSFDVIFPLLHGPNGEDGTVQGMLELLNLPYVG
NGVLASSAGMDKVIMKNIFAQAGLPQVNYVWFVRSEWQKAGETAYEKVEEELGYPCFVKP
ANLGSSVGISKCTNREELAAAFEEAFQFDRKIIVEEGVTAREIELGVLGNDEPECSVAGE
IVPKKDFYDYKAKYEDGDTAMIIPAEITEEEYSTLNEMSIRAFKALDCSGLVRADFFLTR
DGKVMINEVNTMPGFTPFSMFPLLWKHTGVEYPQLIERLVNLAIERHTEKQSIKHTM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagcttggattattatacggcggaaaatccgcagagcataaagtatcaatg
cagacggctcttgctgtcattaaagccttggatttggagaaattcgatatatatcctgtt
tacataaccgaggaaggggaatgggtgaagggcccgatgctcgaagcaccggctgaaagc
gtcaagcagctggagttctcacagggagaggctatgtcgcctgcagccctggcaccggct
atgttcaagtcagctgaagaaagcagctttgacgttatctttccgctccttcacggtccg
aatggcgaagacggcacggttcaggggatgcttgagctccttaaccttccatatgtcggc
aatggcgtgcttgcctcatctgcaggcatggataaagtcatcatgaagaatatctttgcc
caggctggcctgcctcaggtcaactatgtatggttcgtccgcagcgaatggcaaaaggct
ggggaaacagcttatgagaaagtggaagaagaacttggctatccttgctttgtcaagccg
gccaatcttggatcgagtgtaggaatcagcaaatgcacaaatcgtgaagaattggcagca
gcttttgaagaagcattccagttcgaccggaagatcattgtggaggaaggcgtaacagcg
agggaaattgaactcggcgtgcttgggaacgatgagccggagtgttcggtggccggcgaa
atcgtaccgaaaaaagatttctatgattataaagccaagtatgaggatggcgatacagcc
atgatcattcctgctgaaattacagaagaggaatacagcacactgaacgagatgtcgatc
agggctttcaaagcacttgactgctccggactcgtaagggcagacttcttcctgacgcgt
gacggcaaggtcatgatcaatgaggtcaatacaatgcctggctttacgccgttcagcatg
ttcccgcttctttggaagcatacaggcgtggaatatccgcagctgattgaaaggcttgtg
aacctggcgattgaaaggcatacggagaaacaaagcatcaaacatacaatgtga

DBGET integrated database retrieval system