KEGG   Brachyspira intermedia: Bint_1240Help
Entry
Bint_1240         CDS       T01847                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bip  Brachyspira intermedia
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bint_1240
Enzymes [BR:bip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bint_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1396979..1397848
Genome map
AA seq 289 aa AA seqDB search
MRRGRLKKILSYKPTVSIIEAHNGLTGLIAEKTTVIKDGRYYQFDGMWVSSLCDSTSRGK
PDIELVDLSSRLQTIDEIMEVTTKPIILDADTGGLIEHFVYNVKTLERIGVSAVIIEDKI
GLKKNSLFGTEVEQQQDTIENFCNKISSGKKVLKTKDFMIIARIESLILEQGMEDALKRA
FAYVEAGADGIMIHSRRKEPDEIFEFCHKFREKDNKTYLVVVPTTFNTVTEDEFADIGVN
IVIYANQLTRSAFPAMKKTAETILYNRRAKEADDMCMSIKDILTLIPEE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaggaagattaaaaaagatactatcttataaaccaacagtttctattatagag
gcacataatggacttactggattaatagctgaaaaaactactgttataaaagatggaaga
tattatcaatttgatggaatgtgggtatctagtttatgcgattctacttctagaggaaaa
ccagatatagaattagttgatttatcgtcaagacttcaaactattgatgaaataatggaa
gttacaactaaacctataatattggatgctgatacaggaggacttatagaacattttgtt
tataatgtaaaaactttggaacgtataggagtttctgctgttatcatagaagataaaata
ggacttaagaaaaattctctttttggtacagaggtagaacagcagcaggatactatagaa
aatttttgtaataaaataagttctggtaaaaaagtattaaagacaaaagactttatgata
atagcgaggatagaaagccttattttagagcaaggaatggaagatgctttaaaaagagcc
tttgcttatgttgaagcgggagctgatggtattatgatacattctagaagaaaagagcct
gatgaaatattcgaattttgtcataagtttagagaaaaagataataaaacttatttggtt
gtagttcctactacattcaatactgttacagaagatgaatttgccgatataggtgttaat
atagttatatatgctaatcaacttacaagaagtgcttttcctgctatgaaaaaaactgct
gaaactatcctttataataggagggcaaaagaagctgatgatatgtgtatgtctataaaa
gatatactcactttaattccagaagaataa

DBGET integrated database retrieval system