KEGG   Bos indicus (zebu cattle): 109574310Help
Entry
109574310         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:biu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    109574310
   04614 Renin-angiotensin system
    109574310
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109574310
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109574310
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109574310
Peptidases [BR:biu01002]
 Metallo Peptidases
  Family M2
   109574310
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109574310
CD molecules [BR:biu04090]
 Proteins
  109574310
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 1306 aa AA seqDB search
MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFAASFNSSAEQV
LFQSTAASWAHDTNITEENARLQEEAALLSQEFSEAWGQKAKDLFDPVWQNFTDPTLLRI
IGAVRTLGPANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNILASSR
SYXLLLYAWEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFTEDL
ERLYQQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGNMWAQSWENIYDTVVPF
PDKPNLDVTBVMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKGQHVSLRRGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSBNLDARPLL
SYFQPVTQWLEEQNQQNGEVLGWPEYQWRPPMPDNYPEGIDLVSDEDEARKFVEEYDRRS
QVVXNEYAEANWNYSTDISTDNSKLLMEKNLQMANHTXKYGTWARKFDVTNFQNATMKRM
IKKIQDLERAALPTKELEEYNQILLDMETVYSVASVCHENGTCLRLEPDLTNLMATSRNY
XDLAWAWKSWRDKVGRSILPYFPXYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQ
LFQELQPLYLNLHAYVRRALHRHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPS
APKMDATEAMIKQGWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHAS
AWDFFNGKDFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGD
VLALSVSTPTHLHKINLLSSGDGGYEEDINFLMKMALEKIAFIPFSFLXDQWRWRVFDGS
VTRENYNQEWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQ
ALCQAAGHQGPLHKCDIYQSKEAGKLLADAMKLGFSQPWPEAMRLITGQSNMSAAAMMTY
FKPLLDWLVTENGRHGEKLGWPQYNWTPNSARLEGPFVGSGRVNFLGLNLEEQQARVGQW
VLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggtcgccggtcgccgccgctgctgctgccgttgctgctgctgctc
ctgccgccgccgcccgtgatcctggagctggaccccgcgttgcagccggggaactttccc
gccgacgaggccggggcgcagatcttcgcagccagcttcaactcgagcgccgagcaggtg
ctgttccagagcacggccgccagctgggcgcacgacaccaacatcaccgaggagaacgcg
cggctccaggaggaagcagccttgctcagccaggagttttcagaggcctggggccagaag
gccaaggatctgttcgacccggtctggcagaactttaccgaccccacgctgctgcgcatc
atcggggcggtgcgcaccctgggccccgccaacctggacctagagaagcggcagaagtac
aactctctgctaagcaacatgagcaggatttactccactgccaaggtctgcttccccaac
aagactgccccctgctggtccctggacccagagctcaccaatatcctggcttcctcgcga
agctacrccctgctgctgtatgcctgggagggctggcacaacgccgcgggcatcccactg
aagcccctataccaggacttcactgccctcagcaacgaggcctacaagcaggatggcttc
tcagacacaggggcctactggcgstcctggtatgactctcccaccttcacggaggatctg
gaacgcctctaccagcagctggagcccctctacctgaacctccatgcctacgtccggcgc
gcactgcaccgccgatatggggacagatacatcaacctcaggggacccatccccgctcac
ctgctggggaacatgtgggcccagagctgggagaacatctacgacacggtggtgcccttc
cccgacaagcccaatcttgatgttaccratgttatggtgcagaagggctggaacgccaca
cacatgttccgggtggcggaggagttcttcacctccctggggctcttgcccatgccaccc
gagttctgggcggaatccatgctggagaagccaagcgacgggcgggaggtggtgtgccac
gcgtccgcctgggacttctacaacaggaaagacttcaggatcaagcagtgcacgcgggtc
actatggaccagctgtccacggtgcaccacgagatgggccacgtgcagtactaccttcag
tacaagggccagcacgtctccctgcgccgaggcgccaaccccggcttccacgaggccatc
ggcgatgtgctggccctctccgtctccactcctgcacacctgcacaagatcggcctgctg
gaccaggtcaccaatgacacagagagtgacatcaactacttgttaaagatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgttggggggtctttagt
gggcgaacccccccttcccgctacaactatgactggtggtatcttcgaaccaagtatcag
gggatctgtcctccggttgtccgaaatgaaacccactttgacgctggagccaagtttcac
gtcccaaatgtgaccccgtatatcaggtacttcgtgagctttgtcctgcagttccagttc
cacgaagcgctgtgcaaggaggcaggccaccaaggccccctgcaccagtgtgacatctac
cagtccacccaggcgggggccaagctccgggcgctgctgcaggcaggctcctcacggccc
tggcaggaggtgctgaaggacatggttggctcaracaacctggacgctaggccgctgctc
agctacttccagccggtcacacagtggctcgaggagcagaaccagcagaacggcgaggtc
ctgggctggccagagtatcagtggcgcccaccgatgcccgacaattacccggagggcatt
gacctggtgtccgacgaggacgaggcccgcaagtttgtggaggaatacgaccggagatcc
caggtcgtgntgaacgagtatgccgaggccaactggaactacagcaccgacatcagcacr
gacaacagcaagttgctgatggagaagaacttacagatggcaaaccacaccrtcaagtat
ggcacctgggccaggaagtttgacgtgaccaacttccagaatgccaccatgaagcggatg
ataaagaagattcaggatctagagcgggcagcactgcccaccaaggagctggaagagtat
aaccagatcctgctggacatggagacygtttacagcgtggcctctgtgtgccacgaaaat
ggcacctgcctgcggctcgagcctgatctgaccaatctgatggccacatcccggaattat
ncagacctggcctgggcgtggaagagctggcgcgataaagtggggcggtccatcctcccc
tacttccccnaatacgtggagctcaccaacaaggccgccaggctcaatggctaccaggat
ggcggggactcctggaggtccatgtaygagatgcccttcctagaggaggagctggagcag
ctgttccaagagctgcagccgctctacctgaacctgcacgcctacgtgcgccgggccctg
caccgccactacgggcccgacgtcatcaacctggagggccccatcccagcccacctgctc
gggaacatgtgggcacagagctggtccaacatctatgacttggtggcacccttcccttca
gcccccaagatggatgccacggaggccatgataaagcagggctggacacccctaaggatg
tttaaggaagcagacaatttcttcacctccctggggctgctgcccatgccccctgaattc
tggaacaagtcgatgctggagaagccgaccgatgggcgggaagtggtgtgccacgcctcy
gcctgggatttcttcaatggcaaggactttaggatcaagcagtgcacctcggtgaacatg
gaggacctggtggtggcccaccacgaaatgggccacatacagtacttcatgcagtacaag
gacttgcccgtgaccttccgggagggcgccaaccccggctttcacgaggccattggggac
gtgctggccctctcagtgtccacccccacgcacctgcacaagatcaacctgctgagcagc
ggggacggcggctacgaggaggatatcaactttctgatgaagatggcgctcgagaagatc
gccttcatccccttcagcttcctcrtcgaccagtggcgctggagggtgttcgatggaagt
gtcaccagggagaactacaaccaggagtggtggagcctcaggctgaagtaccagggtgtc
tgtcccccactggccagatctcaagatgactttgacccaggggccaagttccacattcct
gcaagtgtgccttacgtcaggtacttygtcagctttgtcatccagttccagttccaccag
gcgctgtgtcaggcagcgggccaccagggccccctrcacaagtgtgacatctaccagtcc
aaggaggccgggaagctcctggcggatgccatgaagctgggcttcagtcagccgtggccc
gaagccatgcggctgatcacgggccagtccaacatgtcggctgccgccatgatgacctac
ttcaagccgctgctggactggctcgtgacggagaacgggmggcacggggagaagctgggc
tggcctcagtacaactggacgccaaactcggctcgcctggaaggccccttcgtgggctcc
ggccgcgtcaacttcctgggcctgaacctggaggagcagcaggcccgcgtgggccagtgg
gtgctgctcttcctgggcgtcgccctgctggtggccacgctgggcctcacccagcggctc
ttcagcatccgccaccacagcctccgccggccccaccgcgggccccagtttggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system