KEGG   Bradyrhizobium diazoefficiens USDA 110: bll1162Help
Entry
bll1162           CDS       T00109                                 

Gene name
attY
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    bll1162 (attY)
Enzymes [BR:bja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     bll1162 (attY)
Transporters [BR:bja02000]
 Other Transporters
  Pores ion channels [TC:1]
   bll1162 (attY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 1051234
NCBI-ProteinID: NP_767802
RhizoBase: bll1162
UniProt: Q89V85
LinkDB All DBs
Position
complement(1281438..1282052)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYELVKVDIRAKKLENGEDYLKLNPKGQVPALGLDSG
EIVTEGPVIVQMIADQASAKALAPAHGSAERYKLLEWLNFLTSEVHKSFGPMFAPALNDE
AKAFFKDRVMGKLKYIDSQLAGRDYLMGKQFTVADGYLFTMLTWADRMKFDLSAMPNLTA
YKTRVAARPQVQEALRKEGLAQAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattactcgcccggcgcctgctccctgtccccccacatcgcactcctcgaa
gccggcctgccctacgagctggtcaaggtcgatatccgggccaagaagctcgaaaatggt
gaggattatctgaagctgaaccccaaggggcaggtccctgcgctggggctcgacagcggt
gagatcgtgaccgaaggcccggtgattgtccagatgatcgccgaccaggcttctgccaag
gcgctggcgccggcccatggcagcgccgagcgctacaagctgctcgaatggctgaacttc
ctcacctcggaggtgcacaagagcttcggcccgatgttcgcgccggcgctgaacgacgag
gccaaggcgttcttcaaggatcgcgtcatgggcaagctgaaatacatcgacagccagctc
gccggccgcgactacctgatgggcaagcagttcacggttgccgacggctatctcttcacg
atgctgacctgggccgaccggatgaagtttgatctttcggcgatgcccaacctcaccgcc
tacaagacccgcgtcgcggcacggccacaggtgcaggaggcgctgaggaaggaaggcctc
gcgcaggcaaagtaa

DBGET integrated database retrieval system