KEGG   Bradyrhizobium diazoefficiens USDA 110: bll5402Help
Entry
bll5402           CDS       T00109                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Translation factors [BR:bja03012]
 Eukaryotic Type
  Elongation factors
   bll5402 (tuf)
 Prokaryotic Type
   bll5402 (tuf)
Mitochondrial biogenesis [BR:bja03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    bll5402 (tuf)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   bll5402 (tuf)
  Exosomal proteins of breast cancer cells
   bll5402 (tuf)
  Exosomal proteins of colorectal cancer cells
   bll5402 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(5936988..5938178)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDKIPIIKGSALAALE
DSDKKLGHDAILELMRNVDEYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGLRATQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLAKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgaccgcggcgatcaccaagatcctcgccgagaccggc
ggtgcgacgttcaccgcgtacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgcgcacgtcgagtacgagaccaagaaccgccactacgcccacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtcgtgtcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgcccgcgctcgtcgtgttcctcaacaagtgcgacatg
gtcgacgatcccgagctgctcgagctcgtcgagctcgaagtccgcgagctgctctcgaag
tacgaattcccgggcgacaagatcccgatcatcaagggctcggcgctcgccgctctcgaa
gattcggacaagaagctcggccacgacgccatcctcgaactgatgcgcaacgtcgacgag
tacatcccgcagccggagcgtccgatcgaccagccgttcctgatgccggttgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgcggcatcgtcaag
gtcggcgaggaaatcgagatcgtcggtctgcgtgcgacccagaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggcgctctg
ctccgcggcaccaagcgcgaggacgtcgagcgcggccaggtgctggcgaagccgggttcg
gtcaagccgcacaccaagttcaaggctgaggcctacatcctcaccaaggaagagggcggt
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtcgtgcatctgccggaaggtaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctccgcttcgcgatccgc
gagggcggtcgtaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system