KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6773Help
Entry
bll6773           CDS       T00109                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bja00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    bll6773 (ligD)
Enzymes [BR:bja01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     bll6773 (ligD)
DNA repair and recombination proteins [BR:bja03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     bll6773 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(7468345..7471023)
Genome map
AA seq 892 aa AA seqDB search
MLRKLSTYRQKRDFEKTPEPSGEAAVASSKQRRFVIQKHDASRLHYDFRLEFDGVFKSWA
VTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGQYGGGTVMLWDRGTWEADDPERGFK
KGDLKFTLHGEKLHGSWVLVRMRNDRDGGKRTNWLLIKHRDEYAREGEDILAEDKSVASG
RAMAQIAEGKGRAPKPFMLAKGARGKADAVWQSNRVEETKGRTVAPAPRAALKAGKTVNK
AAKKSATAATNAKTVADMPDFVAPQLCTPVERPPAGDGWCHEIKFDGYRVQLRIEDGKAT
LKTRKGLDWTDKFASIAKEANSLPEAMIDGEIVALDHNGAPNFSSLQAALSDGKTEDLIF
FAFDLLFAEGRDYRRLPLRERKSRLKELLEAQKRKSNQIRYVEHFESGGDAVLQSACKLE
LEGVVSKKLDAPYRSGRTESWTKAKCRAGHEVVIGGWKTTNGKFRSLMAGVHRGDHLVFV
GMVGTGFGADTVKRIMPSLKAMEAKDSPFSGKNAPKKTRDVHWLKPELVAEIEFAGFTAD
GNIRQAAFKGLRQDKPAEEVEAETPADTELARPSAGKRVPAKSGKKKDAGAAEVMGVVIS
KPDKELWPDGGDGEGVTKLDLARYFEAVGGWMIEHLKGRPCSILRAPDGIGGETFFQRHA
MQGTSNLLELAKVSGDRKPYLQIDRVEGLAAVAQIGGLELHPWNCAPDAYDTPGRLVFDL
DPAPDVGFADVVEAAKQMRQRLTDVGMESFCKTTGGKGLHVVVPLLHGARDKVSWKEAKA
FAQGICRWMADDEPERYLLNMSKKLRNGKIFLDYLRNDRLATAVAPLSPRARDGATVSMP
VTWAQVKGDLDPKRYTVRTVPGLLARSKAWEGYDDAAASIKAAMKKLAGKMR
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgaaaactctccacctatcgacagaagcgggacttcgagaagacccctgagccc
tccggcgaggccgcggtagcctcttcgaaacagcgacgcttcgtgatccagaagcatgac
gccagccggctgcactacgatttccgcctcgagttcgacggcgtgttcaagtcctgggcg
gtgacgaagggcccctcgctcgatccgcacgacaagcggctggcggtcgaggtcgaggac
catccgctcgactatggcgatttcgaaggaacgattccggaagggcagtatggcggcggc
acggttatgctgtgggaccgcggcacctgggaggccgatgatcccgagcgtggtttcaag
aagggcgacctgaagttcacgctgcacggcgaaaagctgcacggaagctgggtgctggtc
cgcatgcgcaacgatcgcgatggcggcaagcggaccaactggctgctgatcaagcatcgc
gacgaatatgcccgcgagggcgaggacatccttgccgaggacaagtcagtcgcctccggc
cgcgcgatggcgcagatcgccgaaggcaagggccgcgcgccaaagccgttcatgctggcg
aagggtgccaggggcaaggccgatgcagtgtggcaatccaaccgcgtcgaggagacgaag
gggcggaccgtcgcgccggcgccacgcgccgcgttgaaggccggcaagaccgtaaacaag
gccgcaaagaagagtgccacggcggctacgaacgccaagacggtcgcggacatgccggat
ttcgtcgcgccgcagctctgcacgccggtcgagcgtccgccggccggcgacggctggtgc
cacgagatcaagttcgacggctatcgcgtgcagcttcgcatcgaggatggcaaggcgacg
ctgaagacccgcaagggtctcgactggaccgacaagttcgcctccatcgcgaaggaggcg
aattcgctgccggaggccatgatcgacggcgagattgtcgcgctcgaccacaacggcgcg
ccgaacttctcctcgctccaggccgcgctgtcggatggcaagaccgaggacctcatcttc
tttgccttcgatctcctgttcgccgaaggccgcgactatcgccgccttccgctcagggag
cgtaagtcgcggctcaaggagctgctggaggcacaaaagcggaaatcgaaccagatccgc
tatgtcgagcatttcgagagcggcggcgacgccgtgctgcaatcggcctgcaagctcgag
cttgaaggcgtggtgtcgaagaagctggacgcaccgtaccggtcgggacggacggagagc
tggaccaaggccaaatgccgcgccggccatgaggtcgtgatcggcggctggaagaccacc
aacggcaaattccgctcgctgatggccggtgtgcatcgcggcgatcacctcgtcttcgtc
ggcatggtcggtaccggcttcggcgccgacacggtcaagcgcatcatgccgtcccttaaa
gccatggaggccaaggacagcccgttcagcggcaagaacgcgccgaagaagacgcgggac
gtgcactggctgaagccggagctcgtcgccgaaatcgagttcgccggcttcaccgccgac
ggcaacattcgccaggccgccttcaaggggctgcggcaggacaagccggccgaggaggtc
gaggcggagacgcccgccgataccgagctcgccaggccgtctgctggaaagcgcgttcct
gcgaagtccggaaagaagaaagatgccggcgctgccgaggtcatgggcgtcgtgatctcg
aagccggacaaggagctgtggccggatggcggcgacggcgagggcgttaccaagctcgat
ctcgcgcgctatttcgaggcggtcggcggctggatgatcgagcacctgaaggggcgacct
tgctcgatcctgcgcgcgcccgacggcatcggcggcgagacattcttccagcgccatgcc
atgcagggcacctcgaacctgctcgagctcgccaaggtgtccggcgatcgcaagccgtat
ttgcagatcgatcgcgtcgagggacttgccgcggtcgcgcagatcggcggcctcgagctg
catccctggaactgtgcgccggatgcctatgacacgccgggccggctggtgttcgatctc
gaccccgcgcctgatgtcggtttcgccgatgtcgtcgaggcggccaagcagatgcggcag
cggctcactgacgttggcatggagagcttctgcaagaccaccggcggcaagggcctgcat
gtggtggtgccgctgctccacggcgcgcgcgacaaggtgagctggaaggaggccaaggcg
ttcgcgcaaggaatctgccgatggatggcggatgacgagcccgagcgctatctgctcaac
atgtccaagaagctgcgcaacggaaagatctttctggactatctgcgcaacgatcgcctg
gcgacggcggtggcgccgctatcgccccgcgcccgcgacggcgcgaccgtgtcgatgcct
gtcacctgggcgcaggtgaagggcgatctcgatccgaagcgatatacggtgcggacggtg
ccgggcctgctggcgcgttccaaggcgtgggagggctatgacgatgcggccgcgtcgatc
aaggccgcgatgaagaagcttgcggggaagatgaggtag

DBGET integrated database retrieval system