KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8073Help
Entry
bll8073           CDS       T00109                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     bll8073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(8854146..8855102)
Genome map
AA seq 318 aa AA seqDB search
MRYQLAPLHCRPWTLNGISARLIESHYENNYGGALNRLNIISEEIELLDLGDAPNPTLAR
LKRDEIVALNSTLLHEFYFASLGGDGRVVPDDLASAIAKDFGSVDRWRQEFVGIASALAG
GSGWVLLTYVPRDGRLINQIASEHSQSIAGGVPILALDMYEHAFHLEFGANAGAYIAAFM
RNIDWSAVKQRYEDAIKVAPPRPLEQKEFGDVPAISVEEVREMMKLGTPVQIIDTRPKHY
TAKAQDIMDGAVWRDPERLDDWIGTLSKTEPVVTFCVYGFHIGCQTASALRKAGFDARYM
AGGHYAWKAIKGPVKLFE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcgctaccaactggcaccgcttcactgtcgtccctggacgttgaacgggatctccgct
cgcctcattgaaagccactacgaaaacaactacggcggggccctcaatcgcttgaacatc
atttctgaggagatcgagctcctcgatctcggcgacgcccccaacccgaccctcgcccgg
ctgaagcgcgacgagattgtcgcgctcaactcgacgcttctgcacgaattctattttgcg
agcctcggcggcgacggacgcgtggtgccggacgacctcgcaagcgccatcgcaaaggat
ttcggatcggtggatcgctggcgccaggagttcgtcggcatcgcgtccgcactggccggc
ggctcgggctgggtgctgctgacctacgttccgcgcgacggacggctcatcaatcagatc
gcgtcggaacacagtcaaagcatcgctggcggcgtcccgatcctcgccctcgatatgtac
gagcacgctttccacctggaattcggcgcgaacgccggcgcctacatcgcggccttcatg
cgcaacatcgattggtccgccgtgaagcagcgttatgaggatgccatcaaggtcgcgcct
ccgcgcccgctcgagcaaaaggagtttggcgacgtgccagcgatctccgttgaggaagtc
cgggagatgatgaagttggggacgccggttcagatcatcgatacgcgcccgaagcactac
accgcgaaagcccaggacatcatggacggagccgtatggcgcgatcccgaacggctcgac
gactggattggtaccctgtcgaagaccgaacccgtcgtcacgttctgcgtctacggcttc
cacatcgggtgtcagacggcttcggcactacgcaaggcgggatttgatgcccgctatatg
gcgggcggacattacgcttggaaggcaatcaagggccccgtgaaactcttcgagtga

DBGET integrated database retrieval system