KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2955Help
Entry
blr2955           CDS       T00109                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    blr2955 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    blr2955 (ppc)
   00680 Methane metabolism
    blr2955 (ppc)
Enzymes [BR:bja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     blr2955 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
3257065..3259863
Genome map
AA seq 932 aa AA seqDB search
MSLQTLPSDAADSRPNRPEDVQALEADARLRDDIRLLGRILGDTVRDQEGADLFDLVERI
RQTSIRFHRDEDRLARRELEQILDSMSTSETVRIVRAFSYFSHLANIAEDQNNIRQMRAR
TAAKIGGSGVLADTLAHAKAAGIGPDALRNFFKTALVSPVLTAHPTEVRRKSTMDREMEV
ASLLDRRERVALTEDEAAASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFL
REVPRLVNVLEDRLEEDGDQAASELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSR
VMQFYLNELHVLGSELSIAAHLADVSEELRTLAERSPDTSPHRSGEPYRLAVSGIYARLT
ATAEALEVEITRRPVGKGRPYESVKELQADLDVLHRSLISNNARVIARGRLRLLRRAVDC
FGFHLARLDIRQNSAVHERTIAELMDAANPGMSYLALGEDARISLLTNELRSTRALVSPF
VKYSDETMGELNVFHAAAEAHAKFGSDAIPQCIISMCKGMSDMLEVAVLLKEVGLVHPSG
RSAINIVPLFETIEDLQASSAIMDRMLSLHDYRRLVDSRGSVQEVMLGYSDSNKDGGFVT
SGWELYKAEINLVDVFERHHVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITE
QGEIISSKYSNAEVGRNNLEILAAATLEASLLHPRQSAPRREYLTAMDELSSLAFRAYRG
LVYETDGFVDYFWASTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPG
WYGFGTAVEQWIAEHPDKGMPFLKELYKEWPFFRMLLSNMDMVLAKSSIAIASRYAELVP
DEALREKIFGRIRREWHSCIETLLDIMGQDRLLQGNPLLERSVRHRFPYLDPLNHVQVEL
LREHRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccagacattaccatccgacgccgcagattctcgccccaatcgcccggaggac
gtccaggcgctggaggcggacgcccggctgcgggacgacattcgcctgctcggacgcatc
ctgggcgacacggtgcgcgaccaggagggcgccgacttgttcgacctggtcgagcgcatc
cgccagacctcgatccggttccaccgcgacgaggaccggctcgcccgacgcgagctcgag
cagatcctcgacagcatgtcgacctccgagacggtgcggatcgtccgcgccttcagctat
ttctcccacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgcgcccgc
accgcggccaagatcggcggctccggcgtgctggcggacacgctggcccatgccaaggcc
gcgggcatcggccctgacgccctgcgcaacttcttcaagaccgcgctcgtcagcccggtg
ctgaccgcgcacccgaccgaggtccgccgcaagagcaccatggaccgcgagatggaggtc
gctagcctgctcgaccgccgcgagcgcgtcgcgttgaccgaggacgaagccgccgccagc
gacgagcagctccgccgcgaggtgctgacgctgtggcagaccaatctgcttcgccggacc
aagctcaccgtgctcgacgaggtcgccaacggcctgtccttctacgactacacgttcctg
cgcgaggtgccgcggctggtcaacgtgctggaagaccggctggaggaggacggcgaccag
gcggccagcgagctcgcctcgttcctgcgcatgggcagctggatcggcggcgatcgcgac
ggcaatcccttcgtcaccgccgacgtcatgcgcggcacgctgcggctgcagtcgagccgg
gtgatgcagttctatctgaacgagctgcacgtgctcggctccgagctgtcgatcgcggcc
catctcgccgacgtctccgaggagctgcgcacgctggcggagcgctcgccggatacctcg
ccgcaccggagcggcgagccgtatcgcctcgcggtctccggcatctatgcgcgcctgacg
gcgacggctgaagcgctcgaggtcgagatcacgcgccggccggtcggcaagggcaggccg
tacgagagcgtcaaggagttgcaagccgatctcgacgtgctgcaccgctcgctgatctcc
aacaacgcccgcgtcatcgcccgcggccggctgcggctgttgcgccgcgcggtggactgc
ttcggcttccatctggcgcggctcgacatccgccagaactcggcggtgcacgagcggacc
atcgccgagctgatggacgccgccaaccccggcatgtcctatctcgcgctcggcgaggac
gcgcgcatctcgctgctcaccaacgaactccgcagcacgcgcgcgctggtgtccccgttc
gtcaagtacagcgacgagaccatgggcgagctcaacgtcttccacgccgccgcggaggcg
catgcgaagttcggctcggacgcgatcccccaatgcatcatctcgatgtgcaagggcatg
tcggacatgctcgaggtcgccgtgctgctcaaggaggtgggcctcgtccatccctccggg
cgcagcgcgatcaacatcgtgccgctgttcgagaccatcgaggatctgcaggcctccagc
gccatcatggaccgcatgctgtcgctgcacgattaccgccgcctggtcgacagccgcggc
agcgtgcaggaggtcatgctcggctattccgacagcaacaaggatggcggcttcgtcacc
tcgggctgggagctctacaaggccgagatcaacctcgtcgacgtgttcgagcgccatcac
gtgcgcctgcgcctgttccacggccgcggcggctcggtcggccgcggcggcgggccgagc
tacgacgcgatcatcgcgcagcccggcggcgcggtgaacggccagatccgcatcaccgag
cagggcgagatcatctcgtcgaaatattccaacgccgaagtcggccgcaacaatctggag
atcctggccgccgcgacgctggaggcgagcctgctgcatccgcgccagagcgcgccgcgc
cgcgaatacctcactgcaatggacgaactctcaagtctcgcctttagggcttatcgcggc
ctcgtctacgagaccgacggtttcgtcgattacttctgggcctcgaccgtcatcaacgag
atcgcgacgctcaacatcggcagccgcccggcctcgcgcaagaagacccgcgcgatcgaa
gaccttcgcgccattccctgggtgttctcctgggcgcaatgccgcctgatgctgccgggc
tggtacggctttggcaccgcggtcgagcaatggatcgccgagcatcccgacaagggcatg
ccgttcctcaaagagctctacaaggaatggccgttcttccgcatgctcttgtcgaacatg
gacatggtgctcgccaaaagctcgatcgcgatcgcctcgcgttatgccgagctcgtaccg
gatgaggcgttgcgcgaaaaaatcttcggccgcatccgccgcgaatggcattcctgcatc
gagacgctgctggacatcatgggccaggaccggctgctgcaaggcaacccgctgctcgaa
cgctccgtgcgccaccgcttcccctatctcgacccgctcaaccacgtgcaggtcgagctg
ctgagggagcaccgcgcgcagaacccggacgaacaggtgctgcgcgggattcagctcacc
atcaacggtatctctgcggggctgaggaatacgggctaa

DBGET integrated database retrieval system