KEGG   Bradyrhizobium japonicum E109: RN69_13260Help
Entry
RN69_13260        CDS       T03509                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bjp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RN69_13260
Enzymes [BR:bjp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RN69_13260
Transporters [BR:bjp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RN69_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2830667..2831323
Genome map
AA seq 218 aa AA seqDB search
MAKATLTISSKNYSSWSLRGWLLTKFSGLDFEEIVTAPDDASARAEILLLSSSILVPCLR
HEGAVVWDTLAIAEYLNEAMPDAGLLPDDRVQRAHCRSICGEIHSGFTTLRASLPVNLKG
HFPGFKIWSRAQADIDRVWSIWRDCLEKSGGPFLFGARRTMADAMYAPVVTRFVTYDVKL
EPLLKAYADTIMAMPEMQEWIAAAKDEPAEIEELEVEY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacactgaccatcagcagcaagaactattcgtcctggtcgctgcgtggc
tggctgctgacgaaattttccgggctcgatttcgaggagatcgtcaccgcgccggacgac
gcgtcggcgcgcgcggaaatcctcctgctgtcgtcgtcgatcctggtgccgtgcctgcgc
cacgagggcgccgtggtctgggatacgctggcgatcgccgaatatctcaacgaggcgatg
ccggatgccggtctgctgcctgatgaccgcgtccagcgggcgcattgccgctcgatctgc
ggcgaaatccattccggcttcacaacgttgcgcgcgtcgctgccggtcaatctgaagggg
cacttccccggcttcaagatctggtcgcgcgcgcaggccgatatcgaccgcgtctggtcc
atctggcgcgactgcctggagaaatcaggcggtcccttcctgttcggcgcgaggcgcacc
atggcggatgcgatgtacgcccccgtggtgacgcgcttcgtgacctatgacgtcaagctc
gagccactgctgaaggcctatgccgataccatcatggccatgcccgagatgcaggaatgg
atcgcggcggccaaggatgagccggccgagatcgaggagctcgaggtcgaatattag

DBGET integrated database retrieval system