KEGG   Bacillus kochii: CKF48_15030Help
Entry
CKF48_15030       CDS       T05194                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bko  Bacillus kochii
Brite
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKF48_15030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASV68502
UniProt: A0A248TK42
LinkDB All DBs
Position
2934635..2935195
Genome map
AA seq 186 aa AA seqDB search
MNKKIVYLLFSLSVLLMGCTEQEVKKVDVEMFNAVGDSLGKVKLEEQASGVKLGLDLKGL
PPGDHAIHIHEKGECEAPDFKSAGNHFNPEDKDHGLLNQDGHHAGDLPNIIVEDDGKVKT
DLVAAEVTMKDEKSSLLTKDGTSIVIDEKTDDGMTQPSGDSGERIACGVISKDKEPKQKE
AQNSKS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagatagtttatttattatttagtctatctgttttattaatgggttgtaca
gaacaggaagtaaaaaaggtagatgtagagatgtttaacgcagttggggattctcttggt
aaggttaaattagaagagcaagccagtggggtcaagttagggttagatttaaaaggtctg
ccacctggggatcatgctattcatatccatgagaaaggtgagtgtgaggctcctgacttt
aaatcggctggtaatcactttaatcccgaagataaagatcatggtttactgaatcaagat
ggtcatcatgcgggtgatttacctaatattattgtggaagatgatgggaaagtgaagaca
gacttagttgcagctgaagttacaatgaaagatgaaaagtcttcattattaacaaaagat
ggtacatctattgtcattgatgaaaaaacagatgatggaatgacacagccttctggcgac
tccggggaaagaattgcctgtggagtgatttcgaaagacaaagaaccaaagcagaaagaa
gcacaaaatagtaagagttaa

DBGET integrated database retrieval system