KEGG   Bifidobacterium kashiwanohense JCM 15439 = DSM 21854: BBKW_0022Help
Entry
BBKW_0022         CDS       T04223                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bks  Bifidobacterium kashiwanohense JCM 15439 = DSM 21854
Pathway
bks00620  Pyruvate metabolism
bks00680  Methane metabolism
bks01100  Metabolic pathways
bks01120  Microbial metabolism in diverse environments
bks01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bks00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBKW_0022
  Energy metabolism
   00680 Methane metabolism
    BBKW_0022
Enzymes [BR:bks01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBKW_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAQ28157
LinkDB All DBs
Position
complement(28999..31755)
Genome map
AA seq 918 aa AA seqDB search
MTVENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQILREVLGEFDEKLLAKF
DEVREHALNASDERFSGILTDTNPDQDDLQKVVDIIDKTDVREAQLLARAFTTYFHLANL
CEENYRVSVLHSREAAVDETQAVDPVNEMTCAYHQLINEMGPAKAKELLDQLEFHPVFTA
HPTEARRKAVEGKIRRISQLLATHKLLGGSDKKENSRRLFNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVCPSFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLGALQIETRRVGKNLTMEAETTPPSAELKSLWNHQKEMSERLT
DKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCGDYIADLKVVQRSLAEANAKRS
AYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGELQPMTHEVLDT
FRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLE
DLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYSDSSKDAGPTSATLALHSAQERIAK
WAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPAL
AIRHVESVAAATLLQSAPSVEKRNTDMTAKYADMASKLDEAAHNRFLDLLNTDGFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEQFG
DLDTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDREDLNKKVLDEMELTRKW
VLEIVGDKWPLQHRHVLGQAIRIRSPYVDALSATQVLALGSLRKRVDKEELTHGQKANYT
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagaaaacgaacagatcacgcctgccgacgcagctatcgtctcgtccggcacc
ggcaccaaaggccccgaggagcgtgatcttcccgcttccctcaaagaggaaatggatctg
tgtttgcagattcttcgcgaggtgctcggcgaattcgatgaaaagctgctggccaaattc
gatgaagtgcgcgaacacgcactgaacgctagcgacgaacgtttctccggcattctgacg
gatacgaatccagatcaggatgacctgcagaaggtcgtcgacatcatcgataaaacggat
gtgcgtgaggcacaactgctggcccgcgccttcaccacctacttccatctggccaacctt
tgcgaggagaactaccgcgtctccgtgctacacagccgtgaggccgccgtagatgaaacc
caagccgtcgaccccgtgaacgaaatgacctgcgcctaccaccagctcattaacgaaatg
ggtccggccaaagccaaggaactgctcgaccagctcgagttccatccggtgttcaccgcg
catccgactgaagcccgccgcaaggccgtggaaggcaaaatccgccgcatctcccagctg
ctcgcaacgcacaagctgcttggcggttcagacaagaaagaaaactcccgtcgactcttc
aacgagatcgacgcgctgttccgcacctctccaatcgcactgaagaagccgactccggtt
gaggaagcggacaccatcctcgatattttcgacaatacgttgttctataccattccacag
gtgtaccgtcgtttcgacgattgggtcctcggagacaaggctggcctcgtgccgccggta
tgcccgtcgttctttcacccgggaagctggatcggctccgaccgtgacggcaacccgaat
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccacgtgctgggcgcg
ttgcaaatcgagacccgccgcgttggcaagaacctgacgatggaagctgagaccaccccg
ccgagtgccgagctcaagagcctgtggaaccaccagaaggaaatgagcgagcgcctgacc
gacaaggccgcgctgatctccaccaaggagttgcaccgtgccgtcatgctggtcatggcc
gatcgtctgaaggccaccatcgaccgcgatgctgatctcatgtaccactcctgcggggat
tacatcgccgacctgaaggtcgtgcagcgctccctcgccgaagccaacgccaagcgttcc
gcctacggcccgttgcaggacctcatctggcaggcagagacctttggcttccatatggtc
gagatggagttccgccagcactccgtcgtgcattcccgagcgctggaggatatccgcgaa
catggtctgcacggtgagcgtggcgaactgcagccgatgacccacgaggtgcttgacacc
ttccgcgccctcggttccatccagaagcgcaacggtatcaaggccgcccgtcgttacatc
atctccttcaccaagagcgcccaaaacatcaaggacgtgtacgagctgaaccgtctggcg
ttctcccatcccgaggatgttccaaccatcgacgtgatcccgctgttcgaacagcttgag
gatctgcagaactcggtggacgtactcgaggaaatgatcaagattccggaggtccaggct
cgtctgaaagccaccggcggcaagatggaagtcatgctcggctactccgactcctcgaag
gacgccggcccgacctccgcaaccctggccctgcattccgcacaggaacgcatcgccaag
tgggcggaatcgcatgacatcgatctgaccctgttccatggccgcggcggcgccgtcggc
cgcggcggcggcccggctaaccgtgccgtgctcgcacagccggtcggctccgtgaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcacgctacggcaacccggcactg
gccatccgccacgtcgagtccgttgcggctgcaacgctgctgcagtccgctccgagcgtg
gagaagcgcaatacggacatgaccgccaagtacgccgacatggccagcaagctcgacgag
gccgcgcataaccgcttcctcgacctgttgaacaccgacggcttcgcaccgtggttctcc
accgtcacgccgctgaccgaaatcggcctgctgccgatcggctcccgtccggccaaacgt
ggccttggagccaagtccctcgacgatctgcgtaccattccgtggatcttctcctgggcg
caggcacgcatcaatctggccgcatggtacggcctgggcaccgcgtgcgagcagttcggc
gatttggacaccttgcgtcaagcatatgaggaatggcctctgttctccacgttcatcgac
aacatcgaaatgtcgctggccaagactgacgagcgcatcgccaagatgtaccttgctctc
ggagaccgtgaggacctcaacaagaaggtcctcgacgagatggagctcacccgcaagtgg
gtgctcgagatcgtaggcgacaagtggccgctgcagcaccgccacgtgctcggccaggcc
atccgcatccgctcgccgtacgtggatgcgctgtccgccacccaggtgctcgccctcggc
tcgctacgcaagcgcgtggacaaggaagagctcacgcacggacagaaggcgaactacacc
tacctgatcctgtgcaccgtgtccggtgtcgcagcaggcctgcagaacacgggctga

DBGET integrated database retrieval system