KEGG   Burkholderia latens: WK25_11745Help
Entry
WK25_11745        CDS       T04819                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blat  Burkholderia latens
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:blat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WK25_11745
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    WK25_11745
   00680 Methane metabolism
    WK25_11745
Enzymes [BR:blat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WK25_11745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2529296..2532292
Genome map
AA seq 998 aa AA seqDB search
MKSSGSARTVRRNAALPSSDAQTGTLATAANGRAKPATKPKDPIRQTKRAIDAADTAAGT
AKRGTRTRDDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSEA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYA
LEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTA
RERAYNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLQARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGASDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRVGEGTVPVRS
AGRGAPPVRAVPYADSDAFVADLKVLTASLDEHHGASLAAPRLAPLVRAAEVFGFHLASI
DLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSALAQ
SELGVFEKAREVRAQFGARAVRNYIISHTESVSDLVEVLLLQKETGLLEGTLGSHAKNGL
MVIPLFETIPDLRDAARIMRDYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTSNWE
LYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEV
IASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDTAMASYRELVY
ETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLT
GWYGFGSAVSAYLDGAPDAAERTKRLALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASR
YAQLVADRKLRKHVFERIVAEWERTSHALAEITGHEGRLATNPLLARSIKNRFPYLDPLN
HLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggtgcgccgcaatgctgccctgccctcctccgac
gcccagacgggcaccctcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcagacaaaacgcgcgatcgacgcagccgacaccgctgccggcacg
gcgaagcgcggcacgcgcacgcgcgacgacaaggaccgcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtcgtgcgcgaacaggaaggcgatacggtgttcgac
gtcgtcgagacgattcgccagacggcggtgaagtttcgccgcgaggacgacagcgaagcc
gcgcaaacgctggagaaaaagctgcgcaagctgacgccggagcaaacggtgagcgtcgtg
cgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccaccacaaccgg
cgccgccgcatccacgcgctggcaggctccgcgccgcagccgggcaccgtcgcgtacgcg
ctcgaacagctgaaaacgaccggcaacgcatcgaagcggctgctgcagcgcttcttcgac
gatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatt
ctcgacgcgcagcacgacatcgcccgcctgctcgccgaacgcgaccagccgctgaccgcg
cgcgaacgcgcgtacaacgagtcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacc
cgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgaactgcccgcgctgtacggcgacatcgaggctgcgctc
gccgagcacggcctgcaggcgcgcgtgcctgcattcttccagatgggcagctggatcggc
ggcgatcgcgacggcaatccgaacgtgacggccgcaacgctcgacgaagcgatcaaccgc
caggccgcggtgatcctcgaacactatctggaacaggtgcacaagctcggcgccgagttg
tcggtgtcgaacctgctggtcggcgcgagcgacgcagtgaaggcacttgcggcggcgtcg
cccgaccagtcgccgcatcgcgtcgacgaaccgtaccgccgtgcgctgatcggcatctac
acgcggctcgcggcgagcgcgcgcgtgcgcgtcggcgagggcacggtcccggtgcgcagc
gccggccgcggcgcgccgccggttcgcgcggttccgtatgcggactccgacgcattcgtc
gccgacctgaaggtgctgacggcgtcgctcgacgaacatcacggcgcgtcgctggccgcg
ccgcggctcgcgccgctcgtgcgcgcggcagaagtgttcggcttccatctcgcgagcatc
gacctgcgccagagctccgacattcacgaagccgtggtcgccgagctgttcgcgcgtgca
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagcttcgcgtactgctcgcc
gcgctcgccgatccgcgcccgctgcgctcgccatacctcgagtattcggcgctcgcgcag
agcgaactcggcgtgttcgagaaggcgcgcgaagtgcgcgcgcagttcggcgcgcgcgcg
gtgcgcaactacatcatttcgcatacggaaagcgtcagcgaccttgtcgaggtgctgctg
ctgcagaaggaaaccggcctgctcgaaggcacgctcggcagtcatgcgaagaacgggctg
atggtgatcccgctgttcgagacgatccccgacctgcgcgacgccgcgcgcatcatgcgc
gattacttcgcactgccgggcatcgatgcgctcatcgcgcaccagggcgccgagcaggaa
gtgatgctcggctactccgacagcaacaaggacggcggcttcctgacgtcgaactgggaa
ctgtatcgcgccgaactcgcgctcgtcgacctgttccgcgaacgcaagatcacgctgcgc
ctgttccatggtcgaggcggcacggtcggccgcggaggcggcccgacctaccaggcaatc
ctgtcgcagccgccgggcaccgtgaacggccagatccgcctgaccgagcagggcgaagtg
atcgcgagcaagttcgcgaacccggagatcggccggcgcaacctcgagacggtcgttgcc
gcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgcccgcgcagctgcccgcgttc
gaggccgcgatgcagacgctgtccgataccgcgatggcgtcgtatcgcgagctcgtttat
gaaaccccgggcttcaccgactacttcttctcgtcgacgccgatcaccgaaatcgcggag
ctgaacatcggcagccgtccggcgtcgcgcaagctgcaggatccgaagaaccgcaagatc
gaagacctgcgcgcgattccgtggggcttctcgtgggggcagtgccggctgctgctgacc
ggctggtacggcttcggcagcgcggtgagcgcgtatctcgacggcgcgcccgacgcggcc
gagcgcacgaagcggttggcgctgctcaagaagatgaacaagacgtggccgttcttcgcg
aacctgctgtcgaacatggacatggtgctcgcaaagaccgatctcgccgttgcgtcgcgc
tacgcgcaactggtcgccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgcc
gaatgggagcgcacgtcgcacgcgctcgccgaaatcaccgggcatgaagggcgtctcgcg
accaacccgctgctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctaaac
cacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgacacgaacgcgcggctgcgt
cgcgggattcacctgaccatcaacgggatcgcggccggcctgcgcaataccggctga

DBGET integrated database retrieval system