KEGG   Bifidobacterium longum subsp. longum F8: BIL_19140Help
Entry
BIL_19140         CDS       T02580                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BIL_19140
  Energy metabolism
   00680 Methane metabolism
    BIL_19140
Enzymes [BR:blg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BIL_19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2234689..2237442
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVPVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTEKYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgttg
cacgacgcccagctgctggcccgcgcgttcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccacgagcgcgagaacaacgtgcccgttgaccag
gcggtcgacccgatcaacgagctcaccgtcgcttaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgtcgtaaggccgtggaaggcaagattcgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gaaatcgacgccctgttccgcacttctccaatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtt
taccgtcgcttcgacgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtaatcgccgccctt
gaggaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgccg
agcgccgagctcaagagcctctggagccaccagaaggaaatgagcgagcgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgac
cgtctgcactacaccatcgagcgcgacgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcac
ggcctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgccctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagtgcccagaacatcaaggatgtctacgagctcaaccgcttggccttc
tcccacccggaggacgtgcccaccatcgacgtgattccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggttcaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggttactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcattgccaagtgg
gctgagtcgcacgacatcgatctgaccctgttccatggccgtggcggcgccgtaggtcgt
ggcggcggccccgccaaccgtgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgttacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagcgtggag
aagcgcaacaccgagatgaccgagaagtatgccgacatggccgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgttgaacaccgacggctttgccccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgcacgattccgtggatcttctcctgggcccag
gcccgcatcaacctggccgcctggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccaccttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtgctcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggcgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcatccgctccccgtacgtggacgcgctgtccgtcacccaggtgctcgccctcaggtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccaacaggcaggattcatctac
ctcatcctgtgcaccgtctccggcgtcgccgcgggcctgcagaacacgggctga

DBGET integrated database retrieval system