KEGG   Bacillus licheniformis ATCC 14580: BL03706Help
Entry
BL03706           CDS       T00197                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BL03706 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2583832..2584440)
Genome map
AA seq 202 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN
LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGGGAPTGELAEAINSKFGSFDQFKEDFA
AAAAGRFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YIKAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattaccttatgcttacgatgcgttagaacctcacatcgac
aaagagacgatgaatattcaccatacgaagcaccataacacatatgttacaaaattgaac
gaagcggtggcaggcaaacaggatcttgaaagcaaatctgttgaagagcttgttgcaaac
cttgatgcagtaccggaaaacatccgtacagctgtccgcaacaatggcggagggcatgcc
aaccactcattgttctggaaacttctttctccaaacggaggaggcgctccaactggtgaa
ttggcagaagccatcaacagcaaattcggcagcttcgatcaattcaaagaagactttgcg
gctgcagcagcaggccgtttcggctccggctgggcatggcttgttgtcaataacggagag
cttgaaatcacaagcacgccaaaccaagattctcctctttcagaaggcaagactcctatc
ttaggtcttgatgtatgggagcacgcatactacctgaattatcaaaaccgccgtccagat
tacattaaagcattctggaacgtcgttaactgggatgaagttgcacgcctttacagcgaa
gcaaaataa

DBGET integrated database retrieval system