KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0646Help
Entry
Blon_0646         CDS       T00794                                 

Definition
(GenBank) glycosyl hydrolase, BNR repeat-containing protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Blon_0646
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Blon_0646
Enzymes [BR:bln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Blon_0646
Bacterial toxins [BR:bln02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Blon_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(742898..745180)
Genome map
AA seq 760 aa AA seqDB search
MAASNPISWSQRTFPSPEGTIACRFRAHADGRIFDAVNGSANDAPLLICAIEHDALRVRA
TTPRQHVDFDIEDTTGIADGAMHTFALTFGEFGTRVYLDGSQCFSGTANLCPTTLTGTEG
SGQGAIRLAGPSIDVTDMRLHAIPLTSESIAALTPRPAPDIDFAAAQLAPRDVRRVRTLR
SGTIFMHFRVRGPRQYGTLLAAGERGEERLAVSIDDNGITMTAADGLYEPSTYHARGAWD
DGRWHDLSIRSARGAIDMYVDGWHELHQAGQVFFGDWPQLDEVAIGQNTEGVRLMGEVRN
GGVFTTPLTDGAIRRLSDAPALTTTALFDKGYHGSVSYRIPSIIRTPHGVVVAGADQRTA
IANDAPNHINFVMRRSLDGGRTWLDMQTVIANPGEGVDGACTIDSCLVCDERNGRLTVLI
DRFAGGVGLPNNTPGTGVDRHGRPCLYDRAGTRYVLADDGTVLDGGGERTGYRVDAHGNV
THEGRASGNIYLKEGADPDESLLIERTSFIIELHSDDDGETWSTPRNINHMIKEDWMHFL
GVSPGNGIQLQASEHRGRLLVPFYCTGASLKHYSGGALISDDGGDTWRRGSMINDGRIVN
GTAVDPKNIRDDDATTHESVFVERADGTVVCFFRNQNHAGRIGVALSHDGGETWDDLYFD
KDVPDIFCQPNAVACAPRSDTMVFANASQMLPYRGNGVLRLSLDGARTWAAHRCINPYHY
GYQCMTMLPDGELGLLWERETAGLYFTTLPLSVFGAAETH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatccaacccgatcagctggtcacagcgaacattcccctcacccgaaggcacg
atcgcgtgcagattccgcgcacacgcggacggccgcatcttcgatgccgtcaatggatcg
gcgaatgacgcgccgctcctcatatgcgccatcgaacatgacgctctgcgcgtgcgcgcg
acgacgccacgacagcacgtcgatttcgacatcgaggacacgacggggatagccgacggc
gccatgcacacgttcgcgctcacattcggcgagttcggcacgcgcgtctacctcgacggc
tcccagtgcttcagcggcacggcgaacctgtgccccacgacgctcaccggaaccgagggg
tcaggccaaggcgcgattcgcctcgcgggcccgtccatcgacgtgaccgacatgcgtctg
catgcaatccccctcacctccgaaagcatcgccgccttgacgccgagacccgcaccggac
atcgacttcgccgcggcccagctcgccccgcgagatgtgcgccgcgtgcgcacgctacgt
tccggcacgatcttcatgcattttcgtgtgcgcggaccccgccagtacggcacgcttctc
gccgccggcgagcgcggcgaggaacgcctcgccgtctcgatcgacgacaacggcatcacg
atgacggccgcggatggcctgtatgagccatccacctaccatgcgcgcggcgcatgggat
gacggccgatggcatgatctgtcgattcgttccgcgcgtggcgccatcgacatgtacgtc
gacggctggcacgaactgcatcaagcgggacaggtgttcttcggcgactggccgcaactg
gatgaggtggccatcgggcagaacacggaaggcgtcaggctcatgggcgaggtgcgcaac
ggcggcgtcttcacgaccccgctcaccgacggcgcgatccgcaggctttcggacgcaccg
gcgctaacgacgaccgcactgttcgacaagggttaccacggatccgtgagttatcgcatc
ccctcgatcatccgcacccctcatggcgtggtcgtcgccggcgccgaccagcgcaccgcg
attgcgaatgacgcgccgaaccacatcaacttcgtcatgcgcaggtcgcttgacggtggc
cgcacctggctcgacatgcagaccgtgatcgccaatccgggcgaaggcgtcgacggcgcg
tgcacaatcgactcatgtcttgtatgcgacgaacgcaatggccgtctcaccgtcctcatc
gaccgcttcgccggcggcgtcgggttgccgaacaacacgcccggcaccggggtcgaccgg
cacgggcgaccgtgcctgtacgatcgcgcaggcacacgctatgtactcgccgatgacggc
acggtgcttgacggcggcggcgagcgcaccggataccgggtcgacgcgcacggcaacgtg
acgcacgagggacgggcctcgggcaacatctacctcaaggagggcgctgaccccgacgaa
tcactgctcatcgaacgcacgagcttcatcatcgaactgcattccgacgatgacggcgag
acgtggagcacaccacgcaacatcaaccacatgatcaaggaggattggatgcacttcctg
ggcgtctcgcccggcaacggcatccagctccaggcctccgaacatcgcgggcgtctgctc
gtcccgttctactgcaccggcgcctcactcaagcattactcgggcggagcgctcatcagc
gacgatggcggcgacacatggcgacgtggttcgatgatcaacgacggccgcatcgtcaac
ggcaccgccgtcgacccgaagaacatccgggacgatgacgcgaccacgcacgaatccgtg
ttcgtcgagcgcgcggatggcaccgtcgtgtgcttcttccgcaaccagaaccatgccggg
cgcatcggcgtcgcgctcagccacgacggcggcgagacatgggatgacctgtacttcgac
aaagacgtccccgacatcttctgccaaccgaacgccgtggcctgcgcgccgcgatcggac
acgatggtgttcgcgaacgcaagccagatgctgccgtatcgcggcaacggggtgctgcgg
ctgagtctggacggcgcacgcacatgggcggcgcatcgctgcatcaacccctatcattac
ggctatcagtgcatgacgatgctgccggacggcgaactcggattactctgggagcgcgag
accgcgggattgtacttcaccacgctgccgttgagcgtattcggcgcggccgaaacgcac
tga

DBGET integrated database retrieval system