KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2422Help
Entry
BLIJ_2422         CDS       T02092                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLIJ_2422
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLIJ_2422
Enzymes [BR:blon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BLIJ_2422
Bacterial toxins [BR:blon02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BLIJ_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2614064..2615248)
Genome map
AA seq 394 aa AA seqDB search
MTENGMMNTNNTVCGANHDGAMSLAAPGDYGVACYRIPALAEAPNGWILAAFDARPHNCQ
DAPQANSIVQRISKDGGRSFEPQHVVAAGHDGVDKYGYSDPSYVVDRQTGEVFLFFVKSY
DAGFGTSQAGVDPSAREVLQAAVTSSIDNGVTWSEPRIITADITNSESWISRFASSGAGI
QLTYGEHAGRLIQQYTIKELDGRYRAVSVFSDDHGATWHAGTPVGDHMDENKVVELSDGR
VMLNSRSSDGNGCRYVAISRDGGATYGPVIRETQLPDPENNAQIARAFPDAPEGSAQAKV
LLYSSSSPSDRIDGLVRVSIDDGKTWSAGRRFTTGPMAYSVIAALSHKAGGGYGLLYEGD
NNNIMYTRISLDWLNGQLNVDGIGGFPLSGEGGC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaacgggatgatgaatacgaacaatactgtgtgcggcgcgaaccatgacgga
gcgatgagtctggcggccccaggcgattacggtgtggcctgctaccggattccggccctt
gccgaggcgcccaacggctggatcctcgcggcgttcgacgcgcggccccataactgccag
gatgccccgcaagccaattcgatcgtgcagcgtatctccaaagacggcggccggtcattc
gagccgcagcatgttgtggccgccgggcatgatggcgtcgacaaatacgggtattccgat
ccgtcctatgtggtggaccggcagacgggagaggtgttcctgttcttcgtcaaatcctat
gacgccggtttcggaacctcccaggcgggcgtcgatccctctgcgcgtgaggtgcttcaa
gccgccgtcaccagttccatcgacaatggcgtgacgtggagcgagccgcgcatcatcacc
gccgacatcacgaacagcgaatcatggatttcacggttcgcttcttccggtgccggcatc
cagctcacgtatggcgagcatgcggggcgcctgatccagcagtacaccatcaaggagctc
gacggccgctaccgtgcggtatcggtcttctccgacgatcacggtgcaacctggcatgca
ggcacccccgtcggcgatcacatggacgagaacaaagtcgtggaactttccgatggccgt
gtgatgctgaactcgcgttcctccgatggaaacggttgccgctatgtcgccatctcccgg
gacggtggcgccacgtatggtccggtgatccgtgaaacgcagctgcccgatcccgagaac
aacgcgcagattgcccgtgcgttccccgatgcccccgaggggtcggcgcaggccaaggtt
ctgctgtattcctcctcgtcgccttcggacaggatcgatggtctggtgcgcgtctcgatc
gatgacggcaagacctggagtgccggccgacggttcacgacagggccgatggcgtattcg
gtgatcgccgcattgagccacaaggccggcggcggctatggcctgctgtatgaaggtgat
aataataacattatgtacacccgtatctcgctcgactggctcaacggccagctgaacgtc
gacggaatcggcggttttccgctgtctggtgagggagggtgctga

DBGET integrated database retrieval system