KEGG   Bifidobacterium longum BXY01: GS08_00205Help
Entry
GS08_00205        CDS       T03387                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blx  Bifidobacterium longum BXY01
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GS08_00205
  Energy metabolism
   00680 Methane metabolism
    GS08_00205
Enzymes [BR:blx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GS08_00205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(43414..46167)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEQATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTERYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgctg
cacgacgcccagctgctggcccgcgcattcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgtgtttccgtgctccacgagcgcgagaacaacgtgtccgttgaccag
gcggtcgacccgatcaacgagctcaccgtcgcctaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgccgtaaggccgtggaaggcaagatccgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccgatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtc
taccgtcgcttcgacgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggctccgaccgcgacggtaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtaatcgccgccctt
gagcaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgccg
agcgccgagctcaagagcctctggagccaccagaaggaaatgagcgagcgtctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgac
cgtctgcactacaccatcgagcgcgacgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcac
ggcctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgccctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggccttc
tcccacccggaggacgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggttcaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcatcgccaaatgg
gctgagtcgcacgacatcgacctgaccctgttccatggccgcggcggtgccgtcggtcgt
ggcggcggccccgccaaccgcgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgttacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagtgtggag
aagcgcaacaccgagatgaccgagaggtacgccgatatggccgctcagctcgacgaggcc
gcgcacaaccgtttcctcgacctgttgaacaccgacggctttgccccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgtacgattccgtggatcttctcttgggcccag
gcccgcatcaacctggccgcctggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccaccttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtgctcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggcgacaagtggccgctgcagcaccgtcacgtgctcggccaggccatc
cgcatccgctccccatacgtggacgcgctgtccgtcactcaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacaggctga

DBGET integrated database retrieval system