KEGG   Brucella melitensis bv. 1 16M: BMEI1367Help
Entry
BMEI1367          CDS       T00072                                 

Definition
(GenBank) superoxide dismutase (mn)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Brite
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMEI1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(1421503..1422234)
Genome map
AA seq 243 aa AA seqDB search
MRHCAIAARIVAAYVDCARKFCSCIRASSICFARRKLKEKRRVSMAFELPALPYDYDALA
PFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKESFGKNQALFNNAGQHYN
HILFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGAGQFGSGWAWLSVKDGK
LEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEAFVDSLVNWDYVLEMYE
KAA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccattgcgccattgccgcccgcattgttgcggcttatgtagattgcgcacgcaag
ttttgctcttgcatccgggcatcatctatttgctttgcccgccgcaagcttaaagaaaag
aggagagtttccatggctttcgaactgcccgcccttccgtatgactatgatgcgcttgcg
cctttcatgtcgcgcgaaacgcttgaatatcatcacgacaagcatcatcaggcctatgtc
accaacggtaacaagcttctcgaaggttccggcctggaaggcaagagcctcgaagaaatc
gtcaaggaaagcttcggcaagaatcaggccctcttcaacaatgccggccagcactacaac
catatccttttctggaaatggatgaagaaggatggcggcggcaagaaactgccgggcaag
ctggaaaaggcctttgattccgatcttggcggttatgacaagttccgcgctgatttcatc
gctgccggtgccggccagttcggttcgggctgggcctggctttccgtcaaggacggcaag
cttgaaatttccaagaccccgaacggtgaaaacccgctcgtgcacggtgcggcgccgatc
ctcggcgtggatgtgtgggaacactcctattacatcgattaccgcaacgcgcgtccgaaa
tatctcgaagctttcgtcgatagcctcgtgaactgggattacgtgctggaaatgtacgaa
aaggcggcataa

DBGET integrated database retrieval system