KEGG   Burkholderia metallica: WJ16_12480Help
Entry
WJ16_12480        CDS       T04871                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmec  Burkholderia metallica
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmec00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WJ16_12480
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    WJ16_12480
   00680 Methane metabolism
    WJ16_12480
Enzymes [BR:bmec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WJ16_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2770269..2773274
Genome map
AA seq 1001 aa AA seqDB search
MKSSGSARTARRNAALSSSDASTDTVATAANGRAKTATKPKDPIRQTKRATKTAGPAART
AKPGTRTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDNEA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSASQPGTVAYA
LEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQELTS
RERQYNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLSARVPAFFQMGSWIGGDRDGNPNVTATTLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGASDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRS
AGRGAPPVRAVPYADSEAFVADLKVLTASLDEHHGTSLAAPRLAPLVRAAEVFGFHLASI
DLRQSSDIHEAVVAELFSRAGVEADYAALAEEDKLRVLLAALADPRPLRSPYIEYSALAQ
SELGVFEKAREVRAQFGERAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGVPGGDAK
NSLMVIPLFETIPDLRDAARIMREYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTS
NWELYRAELALVDLFRDRKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQ
GEVIASKFANPEIGRRNLETVVAATLEATLLPQNNAPAQLPAFEAAMQTLSDSAMAAYRA
LVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKQRRIEDLRAIPWGFSWGQCRL
LLTGWYGFGSAVSAYLDGAQDDAERTKRVALLRKMNKTWPFFSNLMSNMDMVLAKTDLAV
ASRYAQLVSDRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFPYLD
PLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccctgtcctcctccgac
gcctcgacggacaccgtcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacgtcagacaaaacgcgcgacgaaaaccgccggcccggcagcccgcacc
gcgaagcccggcacgcgcacgcgtgaagacaaggacggcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgatacggtattcgac
gtcgtcgagacgatccgccagaccgcggtcaagttccgccgcgaagacgacaacgaagcc
gcgcagacgctcgagaagaagctgcgcaagctgacgcccgaacagacggtgagcgtcgtg
cgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccatcacaaccgc
cgccgccgcatccacgcgctggccggctccgcgtcgcagcccggcacggtcgcgtacgcg
ctcgaacagttgaagacgaccggaaacgcgtccaagcgcctgctgcagcgcttcttcgac
gatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatt
ctcgacgcgcagcacgacatcgcgcgcctgctcgccgagcgcgaccaggaactgacgagc
cgcgagcgccagtacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacg
cgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgaggccgcgctt
gccgagcacggcctgtccgcacgcgtacctgcgttcttccagatgggcagctggatcggc
ggcgaccgcgacggcaacccgaacgtgaccgcgacgacgctcgacgaggcgatcaaccgc
caggccgcggtgatcctcgagcactatctggaacaggtgcacaagctcggcgccgagctg
tcggtgtcgaacctgctcgtcggcgcgagcgatgccgtgaaggcgctcgcggcagcgtcc
cccgaccagtcgccgcaccgcgtcgacgagccgtatcgccgcgcgctgatcggcatctac
acgcggctcgccgccagcgcgcgcgtgcgtctcggcgaaggcacggtgccggtgcgcagc
gcgggccgcggcgcgccgcccgtgcgcgcggtcccgtatgcggattccgaagcgttcgtc
gccgatctgaaagtgctgaccgcgtcgctcgacgagcaccacggcacgtcgctcgccgcg
ccgcgcctcgcgccgcttgtgcgcgcggccgaagtgttcggcttccatctcgcgagcatc
gacctgcgccagagctccgacatccacgaagcggtggtcgccgagctgttctcgcgcgcg
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagctgcgcgtgctgctcgcc
gcgctcgccgacccgcgcccgctgcgctcgccatacatcgaatactcggcgctcgcgcag
agcgagctcggcgtgttcgagaaggcacgtgaagtgcgcgcgcaattcggcgaacgcgcg
gtacgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgaagtgctgctg
ctgcagaaggagacgggcctgctcgaaggcgcgctcggcgtgccgggcggcgatgcgaag
aacagcctgatggtgatcccgctgttcgagacgattcccgacctgcgcgacgccgcgcgc
atcatgcgcgaatacttcgcactgccgggcatcgacgcgctgatcgcgcaccagggcgcc
gaacaggaagtgatgctcggctactcggacagcaacaaggacggcggcttcctcacgtcg
aactgggagctgtatcgcgcggagctcgcactggtcgacctgttccgcgaccgcaagatc
acgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggcccgacctac
caggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctgaccgaacag
ggcgaggtgatcgcgagcaagttcgcgaacccggaaatcggccgccgcaacctcgagacg
gtcgtcgccgcgacgctcgaggcgacgctgctgccgcagaacaacgcacccgcgcagctg
ccggcgttcgaggccgcgatgcagacgctgtccgattcggcgatggccgcgtaccgcgcg
ctcgtctatgaaaccccgggcttcaccgactacttcttctcgtcgacgccgatcaccgag
atcgccgagctgaacatcggcagccgccccgcgtcgcgcaagctgcaggacccgaagcaa
cgcaggatcgaagacctgcgcgcgattccgtggggcttctcgtgggggcagtgccggctg
ctgctcacgggctggtacggcttcggcagcgcggtgagtgcgtatctcgacggcgcgcag
gacgacgccgaacgcacgaagcgcgtcgcgctgctgaggaagatgaacaaaacctggccg
ttcttctcgaacctgatgtcgaacatggacatggtgctcgcgaagaccgatctcgcggtc
gcgtcgcgctatgcgcagctcgtgtcagaccgcaagctgcgcaagcacgtgttcgagcgg
atcgtcgcggaatgggagcgcacgtcgcaggcgctcgcggaaatcaccgggcacgaaggc
cgcctcgcgaccaacccgctgctcgcgcgctcgatcaagaaccgcttcccgtatctcgat
ccgctgaaccacctgcaggtcgagctgatcaagcgccaccgcgcgggcgatacgaacgcg
cggctgcgccgcggaattcacctgacgatcaacggaatcgctgccggcctgcgcaatacg
ggctga

DBGET integrated database retrieval system