KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4844Help
Entry
BG04_4844         CDS       T03825                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BG04_4844
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BG04_4844
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BG04_4844
   00430 Taurine and hypotaurine metabolism
    BG04_4844
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BG04_4844
Enzymes [BR:bmeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BG04_4844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4662887..4664290)
Genome map
AA seq 467 aa AA seqDB search
MPQWHPHREQKNLPDEFPVNPLFSRQGEVTIPRLRISDQGMLPETAYQIIHDEIALDGNA
RLNLATFVTTWMEPDAKRLYGESFDKNMIDKDEYPQTAAIEERCVRILADLWNSPNPDTT
MGVSTTGSSEACMLGGLALKRRWQKLRKSKGLSTDRPNIVFSSSVQVVWEKFANYWDVEP
RYVNINPDHPYLDAEGVINAVDENTIGVVPILGVTYTGVYEPIAAIAKVLDELQEKTGLD
IPIHVDAASGGFIAPFLQPDLIWDFRLPRVKSINVSGHKYGLVYPGLGWVIWREKEDLPE
DLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNFLRLGKDGYYAVQKTSQENALFLSKEI
GEMEAFEILADGSDIPVLAWKLKEGYTPNWTLYDLSRQLRTYGWQVPAYPLPADMEEITI
MRIVVRNGFSRDLAHLFMVNFKQAVEFLNSLDRPVLKDTKYDNGFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatggcatccgcatcgtgaacaaaaaaatttacctgatgaatttcctgttaat
ccacttttttctcgacaaggagaagtgacgattccaaggctgcgtatcagtgatcaaggt
atgcttccagaaacagcttatcaaatcattcatgatgaaattgctttagacggaaatgcc
cgtttaaatttagctacgtttgttactacgtggatggagcctgatgcaaagcgtttgtac
ggagaatcttttgataaaaatatgatcgataaagacgagtatccgcagacagcggctatt
gaagagagatgtgtacgtattttagcggatttgtggaattcacctaatcctgatacaacg
atgggcgtttctactacaggttcatctgaagcatgtatgcttggcggactggctttaaaa
agacgctggcagaaactgcgtaaaagtaaagggctatcaacggaccgcccgaacattgta
tttagttcatccgttcaagtggtgtgggagaagttcgcaaactattgggacgtagaacct
cgttatgtgaacattaatccagatcatccttatttagatgcagaaggcgtcattaatgcg
gttgacgaaaatacaattggcgtcgtaccgattcttggagtgacgtatacaggagtttac
gaaccaattgctgctatcgcaaaagtattagatgagttacaggaaaaaacagggttggat
attcctattcatgtagatgccgcttctggaggttttatcgctccatttcttcaaccagac
ctcatctgggatttccgcttgcctcgagtaaagtccattaacgtgtcaggacacaagtat
ggtttagtttatcctggcttgggatgggtgatttggagagaaaaagaggacttgcctgaa
gatcttattttccgcgtttcttatttaggaggcaacatgccaactttcgcgctcaacttc
tctagaccaggagcacaagttcttttacagtactacaatttcttgcgtttaggtaaagac
ggctattatgctgtgcaaaaaacctctcaagaaaacgcgctgtttctcagcaaagaaatt
ggagaaatggaagcattcgaaattcttgctgatggttcagatatcccggttcttgcttgg
aaactgaaagaaggatatacgccaaactggacgctttatgatttgtctagacaactgcgt
acgtatggatggcaagttcctgcttatccgctgcctgcagacatggaagaaataacaatc
atgcgcattgtcgttagaaatggattttcaagggaccttgctcatttatttatggttaat
ttcaaacaagccgttgaatttcttaactcgttggatagacctgttcttaaagacacgaaa
tacgacaatggatttcatcattaa

DBGET integrated database retrieval system