KEGG   Bacillus methanolicus: BMMGA3_11785Help
Entry
BMMGA3_11785      CDS       T03209                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmet  Bacillus methanolicus
Brite
Enzymes [BR:bmet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMMGA3_11785 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIE60752
UniProt: I3EAJ1
LinkDB All DBs
Position
complement(2337887..2338498)
Genome map
AA seq 203 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNNALEGNEELLSKTVEEVISN
LDAVPEAVRTAVRNNGGGHANHSLFWQILSPNGGGEPTGELADAINSKFGSFEGFKEEFT
KAAATRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRPE
YISAFFNVINWDEVAKRYSAAKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccacaattaccttatgcttatgatgcattagagcctcatatcgac
aaagaaacaatgaacatccatcacacaaaacaccacaacacttacgttacaaacttaaac
aacgctttagaaggaaacgaagagcttctttctaaaacagttgaagaagtcatttccaac
cttgatgcagtacctgaagctgtacgtactgccgttcgcaacaacggaggaggccatgca
aaccattctttattctggcaaatcctttctccaaacggcggcggtgagccaactggtgaa
ttagctgatgcgattaacagcaagtttggaagctttgaaggctttaaagaagaatttaca
aaagcagctgcaactcgtttcggttcaggttgggcatggcttgtcgttaacaatggtgaa
cttgaagtgactagcactccaaatcaggattcaccgttaatggaaggtaaaactccaatt
ttaggtttggacgtatgggagcatgcatattacttaaaatatcaaaatcgccgtcctgaa
tatatcagtgctttcttcaatgtgattaactgggatgaagttgctaagcgttacagcgct
gcaaaaaaataa

DBGET integrated database retrieval system