KEGG   Bacillus methanolicus: BMMGA3_13055Help
Entry
BMMGA3_13055      CDS       T03209                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00020  Citrate cycle (TCA cycle)
bmet00480  Glutathione metabolism
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
bmet01130  Biosynthesis of antibiotics
bmet01200  Carbon metabolism
bmet01210  2-Oxocarboxylic acid metabolism
bmet01230  Biosynthesis of amino acids
Module
bmet_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmet_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmet00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMMGA3_13055 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMMGA3_13055 (icd)
Enzymes [BR:bmet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BMMGA3_13055 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIE61001
UniProt: I3ECK4
LinkDB All DBs
Position
complement(2603066..2604334)
Genome map
AA seq 422 aa AA seqDB search
MQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAAQRVLDAAVEKAYKGERKIVWKEV
LAGEKAFKQTGEWLPAETLQTIKEYLIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLRP
VRWFEGVPSPVKRPQDTDMVIFRENTEDIYAGIEYAKGTDEVKKLINFLENELGVNKIRF
PETSGIGIKPISQEGTTRLVRAAINYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELAE
KEFGDKVFTWAQYDRIKEEQGIEAANKAQAEAEAAGKIIVKDAIADIFLQQILTRPREFD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPSS
VILSGVLMFEHLGWNEAANLIIKSMEKTIASKVVTYDFARLMEGAIEVKTSEFGNELIKN
MG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtgaaaaaatcacggtaacaaatggtgtgctaaacgtaccaaataatccgatt
attccatttattgagggggatggaacaggtccggatatttgggctgctgcacaaagagta
ttagacgcagcagttgagaaagcttataaaggcgagcggaaaattgtttggaaagaagtt
cttgccggagaaaaagcttttaaacaaactggagaatggcttcctgctgaaacgctgcaa
acaattaaagaatacttaattgccatcaaaggacctttaacaactcctgtcggaggtgga
atccgttccttaaacgttgctcttcgccaggaactagatttgtttgtgtgcttgcgtcct
gtacgctggtttgaaggagtgccttcaccagtaaaacgcccgcaagatacagacatggtt
attttccgtgaaaatactgaagatatttatgcaggaattgaatatgcaaaaggtactgac
gaagtaaagaaattaattaatttccttgaaaatgaattgggcgtcaataaaatccgattc
cctgaaacttcaggcatcggcataaagcctatttcacaggaaggaacaactcgccttgta
cgtgcggctatcaattatgcaattaaagaaggccgcaagtctgtaactctcgtacataaa
gggaacattatgaaattcactgaaggcgcatttaaaaactggggctacgagcttgctgaa
aaagaatttggcgataaagtatttacttgggctcagtacgaccgcattaaagaagaacag
gggatagaagctgcaaataaagcacaagcagaggcagaagccgcaggaaagatcattgta
aaagatgcaattgctgatattttccttcaacaaattctgactcgtccgcgcgagtttgat
gttgtagcaacaatgaatttaaacggagactatatttccgacgcacttgctgctcaagtt
ggaggaattggaattgctccaggagcaaatattaactatgaaacaggtcatgctattttt
gaagcaacacatggcacagctcctaaatatgcaggattagataaagtaaacccttcttca
gtcatcctttctggagtattaatgtttgagcatttaggatggaatgaagcagcaaatcta
atcattaaatcgatggaaaaaacaattgcttccaaagttgttacgtatgattttgcacgg
ttaatggaaggtgcaattgaagtaaaaacttcagaattcggcaatgagttaattaaaaat
atgggataa

DBGET integrated database retrieval system