KEGG   Bacillus methanolicus: BMMGA3_16090Help
Entry
BMMGA3_16090      CDS       T03209                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00240  Pyrimidine metabolism
bmet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmet00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMMGA3_16090 (tdk)
Enzymes [BR:bmet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BMMGA3_16090 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 IMPDH AAA_22
Motif
Other DBs
NCBI-ProteinID: AIE61571
UniProt: I3EBL9
LinkDB All DBs
Position
complement(3208766..3209344)
Genome map
AA seq 192 aa AA seqDB search
MYVMKQSGWIEVICGSMFSGKSEELIRRVRRTLFAKQKIAVFKPKMDNRYSEAAVVSHNG
TSFTATPISHSTEIFQHIDSEVDVIAIDEVQFFDSEIVDVLQQLANSGYRVIVAGLDQDF
RGEPFGEMPKIMAIAEQVTKLQAVCAVCGSPASRTQRLINGKPASYDDPVILVGASEAYE
PRCRHHHEVPKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtcatgaagcaaagcggatggattgaggtcatttgcggcagcatgttttctgga
aaatcggaagagttaatccggcgtgttcgaagaactctatttgcaaaacaaaaaattgcc
gtttttaagccgaaaatggataatcgctatagcgaggcagcagttgtatcccataacggg
acatcctttacggcaacgccgatttcccattcgacggaaatttttcagcatattgactca
gaggtagatgtcattgctattgacgaagttcaattttttgacagtgaaatcgtggacgtg
ctccagcagctggcgaacagtggatatcgcgttattgttgcaggtttagaccaagatttt
cgcggcgagccttttggagaaatgcctaaaattatggcaattgccgagcaggtgacaaaa
ctccaggccgtttgtgccgtttgtggttcaccggcaagccgcacacaacgattaatcaac
ggcaagcctgcttcatatgatgatccggtcatcttagtcggcgcctccgaagcttatgaa
ccgcgctgccgccatcaccacgaagtgcctaaaaagtga

DBGET integrated database retrieval system