KEGG   Brucella abortus 2308: BAB2_0312Help
Entry
BAB2_0312         CDS       T00304                                 

Definition
(GenBank) Alanine racemase:Protein of unknown function UPF0001:ATP/GTP-binding site motif A (P-loop)
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bmf  Brucella abortus 2308
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAB2_0312
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BAB2_0312
Enzymes [BR:bmf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAB2_0312
Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
 Precursor biosynthesis
  Racemase
   BAB2_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(307721..308911)
Genome map
AA seq 396 aa AA seqDB search
MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPA
FYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVE
NWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDE
PGNAVNARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHD
FSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYA
DGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLED
VARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcatattgaccatt
gatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgccccaacccgt
acggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtcgcaccggct
ttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagcagtggcgctg
aagccctttttgaaacccgacgcaacactttatgtcctgaacggccttcagcccggaacg
gaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaacaggttgaa
aactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctccagttcgat
accggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttcttgagaacgtc
acgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaacggcgacgag
ccgggaaatgcggtaaatgcccgtcagcttgccaagatgacggccttgctcgctcgcctg
ccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaagacctattat
ttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagaggcagcatgac
ttttcggataaggtggcgcacgagaataagaaacccaagcattcgatccttcccgtcctc
accctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgacagttggctat
ggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtcggctatgct
gacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgatacgcgcctg
cccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctcattgccggag
ggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgcctcgaagac
gtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggcaaccgttat
gcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system