KEGG   Bacillus megaterium WSH-002: BMWSH_0036Help
Entry
BMWSH_0036        CDS       T01890                                 

Definition
(GenBank) Alpha amylase catalytic region
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMWSH_0036
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BMWSH_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(36807..38258)
Genome map
AA seq 483 aa AA seqDB search
MERNHTIMQFFEWHVPADGEHWQRLKELAPQLKEQGIDSVWIPPVTKGVSSEDNGYGVYD
LYDLGEFDQKGTVRTKYGTKQELHEAIDACHNHGINVYVDIVMNHKAAADEKETFHVIEV
DPMNRTEEISEPFEIEGWTKFTFEGRGDQYSSFKWNFNHFNGTDYDDKNGKEGVFRIAGE
NKSWNENVDQEFGNYDYLMFANIDYDHPEVREEMIKWGKWLADTLQCDGYRLDAIKHINH
DFIKEFAHELSSSQEKPFYFVGEFWNPELTACQEFLDVIDYQIDLFDVSLHYKLHEASQQ
GRDFDLTTIFDDTLVKTHPLNVVTFVDNHDSQPNESLESWVEDWFKQSAYALILLREDGY
PCVFYGDYFGIGGEHPIEGKEKDISALLHVRYDKAYGQQDDYFDHPNTIGWVRHGVEEFE
KSGCAVVMSNGEDGEKRMFVGEHRSGQTWIDFTNNREDQVVIEEDGYGQFPVNGGSVSVW
AEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttggaacggaatcatacaattatgcaatttttcgaatggcatgtgccagctgatggcgag
cattggcaacgcctcaaagagctcgctcctcaactaaaagaacaaggaattgattccgtg
tggattcccccggttacaaaaggtgtttcatcagaggataatggctacggcgtttacgac
ttatacgatcttggcgaatttgatcaaaaaggaaccgttcgtacaaagtatggaaccaag
caagagctgcatgaagcgattgatgcctgtcataatcatggaattaatgtctatgtggat
attgtaatgaaccataaagctgcagcagatgaaaaagaaacgttccacgtcattgaagtg
gaccccatgaaccgaacagaagaaatttctgaaccttttgaaattgaagggtggacaaag
tttacatttgaagggcgcggcgatcaatattcttctttcaaatggaactttaatcatttt
aacggcactgattacgatgataaaaatggaaaagaaggcgtttttcgtattgcgggagaa
aacaaaagctggaacgaaaatgtggatcaagagtttggcaactacgattatttaatgttt
gcgaatattgattacgatcatcctgaagttcgagaagaaatgatcaaatggggaaaatgg
ttagcagacactctgcagtgcgacggttatcgattagacgccattaaacatattaaccac
gattttattaaagagtttgcccacgaattgtcctcttctcaagaaaagcccttttatttt
gtgggagagttttggaatccagagttaacagcctgtcaggaattcctagacgtgattgat
tatcaaatcgatttgtttgacgtatcgctgcactataaactgcatgaagcctctcagcaa
ggaagagattttgatttaaccacgatttttgatgatacattagtcaagactcaccctttg
aatgttgtcacatttgtagataaccatgactctcagccaaatgaatctttagaatcttgg
gtagaagattggttcaaacaaagtgcttacgctctaattttacttcgtgaagacggctat
ccttgtgtgttttacggagactattttgggataggcggagagcacccaattgagggaaaa
gaaaaagatatttccgctctcttgcatgtacgctatgacaaagcatacggacagcaagac
gattattttgatcacccgaataccattggatgggtaaggcatggtgtagaggaatttgag
aagtctggatgcgctgtggtgatgtcaaacggcgaagatggcgaaaagagaatgttcgtc
ggcgaacaccgaagtggacaaacgtggattgacttcacaaacaaccgagaagatcaagtt
gttattgaagaagatggctacggacagttccctgtaaatggcggctctgtatctgtttgg
gctgaagcataa

DBGET integrated database retrieval system