KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02390Help
Entry
BMULJ_02390       CDS       T00740                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_02390 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMULJ_02390 (ppc)
   00680 Methane metabolism
    BMULJ_02390 (ppc)
Enzymes [BR:bmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMULJ_02390 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2572769..2575783
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSVRATRRNAALPSSDAPTSAVATAANGRAKPATKPKDPIRQTKRAATTRTASART
AATPKSGGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
REAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AHALDKLKTTGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLEELPALYGDIE
AALAEHGLAARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLAPLMRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVVADYASLEEADKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGAPDG
HAKNALMVIPLFETIPDLRDASRIMREYFALPGVDALIHHQGDEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEGAMQTLSDTAMAA
YRALVYETPGFTDYFFASTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVAAYLDGAADAAERGKRLALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAELVPDRKLRNAVFGRIVAEWERTSHALAEITGHEERLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggtgcgcgcgacgcgccgcaatgctgccctgccctcctccgac
gccccgacgagcgccgtcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcagacaaaacgtgcggccacgacgcgcacggcgagcgcgcgcacc
gcggcaacgccgaagtcgggcgggcgcacgcgcgaagacaaggatcgtccgctgttcgaa
gacatccgtttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacg
gtgttcgacgtcgtcgaaacgattcgtcagaccgcggtcaagttccgccgcgaggacgac
cgcgaagccgcacagacgctcgagaagaagctgcgcaagctgacgcccgagcagacggtc
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccac
cacaaccgccgccgccgcatccacgcgctcgcgggctcggcgccgcagccgggcacggtc
gcgcacgcgctcgacaagctgaaaacgaccggcaatgcgtcgaagcgcgtgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtactgaccgcgcacccgaccgaagtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgaacgcgatcaggaa
ctgaccgcgcgcgagcgccagcacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgaggaattgcccgcgctgtacggcgacatcgag
gccgcgctcgcggagcacgggctggccgcgcgcgtgccggcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaatccgaacgtgacggccgccacgctcgacgaagcg
atcaaccgccaggccgccgtgatcctcgagcactatctcgagcaggtgcacaagctgggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgatgcggtgaaggcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctgatc
ggcatctatacgcgccttgccgcaagtgcgcgcgtgcggctcggcgaaggcacggtgccg
gtgcgcagcgcagggcgcggcgcgccgcccgtgcgcgcgacgccgtatgcggattccgac
gagttcgtcgcggacctgaaggtgttgaccgcatcgctcgccgaacatcacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcatgcgcgcggccgaagtgttcggcttccacctc
gcgagcatcgacctgcgccagagctccgacattcacgaagcggtggtcgccgagctgttc
gcgcgcgcgggtgtcgtggccgactacgcgtcgctcgaagaggcggacaagctgcgcgtg
ctgctcgccgcgctggccgatccgcggccgctgcgctcgccgtacctcgaatactcggcg
ctcgcgcaaagcgagctcggcgtgttcgaaaaggcgcgcgaagtgcgggcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcacacggaaacggtcagcgatctcgtcgag
gtgctgctgctgcagaaggagaccggcctgctcgaaggcacgctcggcgcgccggacggc
cacgcgaagaacgcgctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gcgtcgcggatcatgcgcgagtacttcgcgctgccgggcgtcgatgcgctgatccaccat
cagggcgacgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtccaactgggagctgtatcgcgccgagctcgcgctcgtcgaactgttccgcgag
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggc
ccgacctatcaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaagtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgccc
gcccagctgccggccttcgagggcgcgatgcagacgctgtccgacaccgcgatggccgcg
taccgcgcgctcgtctacgaaacgccgggcttcaccgattacttcttcgcgtcgacgccg
atcaccgaaatcgccgagctcaacatcggcagccgcccggcgtcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtcgccgcgtatctggac
ggcgcggccgacgcagcggaacgcggcaagcggctcgcgttgctgaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgctacgccgaactcgtgccggaccgcaagctgcgcaacgcggtg
ttcgggcgcatcgtcgccgagtgggagcgcacgtcgcacgcgctcgcggagatcaccggg
cacgaggaacggctcgcgacgaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgaactgatcaagcgccaccgcgccggcgac
acgaacgcgcggctgcgccgcgggattcatctgaccatcaacggcatcgcggccgggctg
cgcaatacgggctga

DBGET integrated database retrieval system