KEGG   Burkholderia multivorans DDS 15A-1: DM80_2538Help
Entry
DM80_2538         CDS       T03292                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM80_2538
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM80_2538
   00680 Methane metabolism
    DM80_2538
Enzymes [BR:bmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM80_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(2726091..2729105)
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSVRATRRNAALPSSDAPTSAVATAANGRAKPATKPKDAIRQTKRAATTRTANART
AATPKSGGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
REAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AHALDKLKTTGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLEELPALYGDIE
AALAEHGLAARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLAPLMRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVVADYASLEEADKLRVLLAALADPRPLRSPYIEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGAPDG
HAKNALMVIPLFETIPDLRDASRIMREYFALPGVDALIHHQGDEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEGAMQTLSDTAMAA
YRALVYETPGFTDYFFASTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVAAYLDGAADAAERSKRLALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAELVPDRKLRNAVFGRIVAEWERTSHALAEITGHEERLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggtgcgcgcgacgcgccgcaatgctgccctgccctcctccgac
gccccgacgagcgccgtcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacgcgatacgtcagacaaaacgtgcggccacgacgcgcacggcgaacgcgcgcacc
gcggcaacgccgaagtcgggcgggcgcacgcgcgaagacaaggatcgtccgctgttcgaa
gacatccgtttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacg
gtattcgacgtcgtcgagacgattcgtcagaccgcggtcaagttccgccgcgaggacgac
cgcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacgcccgagcagacggtc
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccac
cacaaccgccgccgccgcatccacgcgctcgcgggctcggcgccgcagccgggcacggtc
gcgcacgcgctcgacaagctgaagacgaccggcaatgcgtcgaagcgcgtgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtactgaccgcgcacccgaccgaagtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgaacgcgatcaggaa
ctgacggcgcgcgagcgccagcacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcgtactatcgcgcgacgttcctcgaggaattgcccgcgctgtacggcgacatcgag
gccgcgctcgcggagcacgggctggccgcgcgcgtgccggcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaatccgaacgtgacggccgccacgctcgacgaagcg
atcaaccgccaggccgccgtgatcctcgagcactatctcgagcaggtgcacaagctcggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgatgcggtgaaggcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccctaccgccgcgcgctgatc
ggcatctatacgcgccttgccgcaagtgcgcgcgtgcggctcggcgaaggcacggtgccc
gtgcgcagcgcagggcgcggcgcgccgcccgtgcgcgcgacgccgtatgcggattccgac
gaattcgtcgcggacctgaaggtactgaccgcatcgctcgccgaacatcacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcatgcgcgcggccgaagtgttcggcttccacctc
gcgagcatcgacctgcgccagagctccgacattcacgaagcggtggtcgccgagctgttc
gcgcgcgcgggtgtcgtggccgactacgcgtcgctcgaagaggcggacaagctgcgcgtg
ctgctcgccgcgctggccgatccgcggccgctgcgctcgccgtacatcgaatactcggcg
ctcgcgcaaagcgagctcggcgtgttcgaaaaggcgcgcgaagtgcgggcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcacacggaaacggtcagcgatctcgtcgag
gtgctgctgctccagaaggagaccggcctgctcgaaggcacgctcggcgcgccggacgga
cacgcgaagaacgcgctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gcgtcgcggatcatgcgcgagtacttcgcgctgccgggcgtcgatgcgctgatccaccat
cagggcgacgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtcgaactgggagctttatcgcgccgagctcgcgctcgtcgaactgttccgcgag
cgcaagatcacgctgcggctgttccatggccgcggcggcacggtcggccgcggcggcggc
ccgacctatcaggcgatcctctcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaagtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgccc
gcccagctgccggcgttcgagggcgcgatgcagacgctgtccgacaccgcgatggccgcg
taccgcgcgctcgtctacgaaacgccgggcttcaccgattacttcttcgcgtcgacgccg
atcaccgaaatcgccgagctcaacatcggcagccgcccggcgtcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgttgctgaccggctggtacggcttcggcagcgcggtcgccgcgtatctggac
ggcgcggccgacgcagcggaacgcagcaagcggctcgcgctgctgaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgctacgccgaactcgtgccggaccgcaagctgcgcaacgcggtg
ttcgggcgcatcgtcgccgagtgggagcgcacgtcgcacgcgctcgcggagatcaccgga
cacgaggaacggctcgcgacgaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgaactgatcaagcgccaccgcgccggcgac
acgaacgcgcggctgcgccgcgggattcacctgaccatcaacggcatcgcggccgggctg
cgcaatacgggctga

DBGET integrated database retrieval system