KEGG   Burkholderia multivorans DDS 15A-1: DM80_3632Help
Entry
DM80_3632         CDS       T03292                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00440  Phosphonate and phosphinate metabolism
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmk00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM80_3632 (aepX)
Enzymes [BR:bmk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM80_3632 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AIO72335
UniProt: A0A228DPW6
LinkDB All DBs
Position
2:334680..336368
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLLSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAVVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFAFCSAADDRGLFGQKVLLQRVSSDAAAGTPHGRWIGLLNV
RGAGVERLKAMLATLQARADFDTLDIPALLNALIDAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccggatgctg
ctgagcaacgaactcgaattcctgatggaagcccacaacggcctgtccgcacggatcgtg
cgcgaagccggcttcaagggcatctgggcctcgggcctcgcgatctccgcgcagttcggc
gtacgcgacaacaacgaggcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgtcagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaagcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgaacgcctatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcatcggcgatgcaggccgtcgcccgcgag
atccacgaaagcgaaacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgtctgcaggacgccgacgaatactcggccgctgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcggtcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgcccgttgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtcgtcggcggctatcgc
gcggatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccacgccgaaacg
ggcgaactcgcatcgctcgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgatctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggtgctgctccagcgc
gtgtcgagcgatgccgccgccggcacgccgcacggccgctggatcgggctgctgaacgtg
cgcggcgccggcgtcgagcgtctgaaggcgatgctcgcgacgctgcaggcacgcgccgat
ttcgacacgctcgacatccccgcgctgctcaacgcgctgatcgacgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcatggacaaacgccgctgtccgaaccgggcgccggcaacggaggc
gcgcaatga

DBGET integrated database retrieval system