KEGG   Bacillus velezensis: NG74_00472Help
Entry
NG74_00472        CDS       T03423                                 

Gene name
ddl_1
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmp  Bacillus velezensis
Pathway
bmp00473  D-Alanine metabolism
bmp00550  Peptidoglycan biosynthesis
bmp01100  Metabolic pathways
bmp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NG74_00472 (ddl_1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NG74_00472 (ddl_1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NG74_00472 (ddl_1)
Enzymes [BR:bmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NG74_00472 (ddl_1)
Peptidoglycan biosynthesis and degradation proteins [BR:bmp01011]
 Precursor biosynthesis
  Amino acid ligase
   NG74_00472 (ddl_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIU80629
LinkDB All DBs
Position
461138..462223
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGEWQRGPLLTEPVSN
VKMLQLEQNGESFALSALNREMFPEASPDEKAPIDVVFPLLHGPNGEDGTIQGLLELLNV
PYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEEELGYPC
FVKPANLGSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPICS
AVGEIAPKTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADF
FLTNDGQVLINEVNTMPGFTPFSMFPLLWKEAGVDYSDLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggaaagtcagccgaacacaatgtatcgctg
cagacagcattagctgtaacaaaagcgcttaatactgagaagtttgatatacatccgatt
tacatcactgaaaaaggagaatggcaaagaggcccgctgctgactgagccggtttccaac
gtgaaaatgcttcagctggaacaaaacggtgaaagtttcgctctatcagcattgaaccgg
gaaatgtttcctgaagcgtcgcctgacgaaaaggcgccgatcgatgtcgtatttccgctt
ctccacggaccgaacggtgaagacggcaccattcagggtctgctggaattgctgaacgtt
ccttatgtcggcaacggggtgcttgcatcatcagccggcatggataaagtcatcatgaag
catttgttcgctcaagcggggcttccgcaggcgaagtacgccgctttcttaaaaaaggac
tggaaacagacgccggacagctgcttacagcaggttgaagaggagcttgggtatccatgc
ttcgtcaaaccggcgaacctcggatcaagcgtcggaatcagcaaatgcagaaaccgtgaa
gagcttgaaaaagccttcgaactggcttttgagtatgaccggaaaattgtggtggaagaa
ggaatcgccggcagagaaatcgaaatcggcgtactcggaaatgacgaaccgatatgctcc
gccgtcggtgaaatcgcgccgaaaaccgacttttacgattacaaggcgaaatatgaagac
ggcgacacggatttaatgattcccgcgcaagtgacggatgaacaatatgcggaaatcagc
gagatggcgattaaagccttcaaagcgattgacggatcaggccttgtccgcgccgatttc
ttcctgaccaatgacggtcaagtgctcattaacgaagtgaacacaatgccgggctttacg
ccattcagcatgttcccgctgctttggaaagaagcaggcgtagattacagtgatctgatc
gaacagctggttgagctggcaaaagaacgccatgccgaaaaacagctgattaaacataca
ttttaa

DBGET integrated database retrieval system